KEGG   Paraburkholderia aromaticivorans: CJU94_38075Help
Entry
CJU94_38075       CDS       T05169                                 

Definition
(GenBank) monooxygenase
  KO
K16244  phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00361  Chlorocyclohexane and chlorobenzene degradation
parb00362  Benzoate degradation
parb00623  Toluene degradation
parb01100  Metabolic pathways
parb01120  Microbial metabolism in diverse environments
parb01220  Degradation of aromatic compounds
Module
parb_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CJU94_38075
   00361 Chlorocyclohexane and chlorobenzene degradation
    CJU94_38075
   00623 Toluene degradation
    CJU94_38075
Enzymes [BR:parb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     CJU94_38075
    1.14.13.244  phenol 2-monooxygenase (NADH)
     CJU94_38075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MmoB_DmpM
Motif
Other DBs
NCBI-ProteinID: ASW03960
UniProt: A0A248W003
LinkDB All DBs
Position
pBN2:371368..371637
Genome map
AA seq 89 aa AA seqDB search
MSNVFIAFQANEESRPVVEAILADNPNAVATESPGMVKIDAPGHLTINRQSIEDRIGMKF
DLQQIHINLITLSGYIDEDDEQFTLSWKH
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacgtatttatcgcgtttcaggctaacgaggagtctcgaccggtggtggaggcg
attctcgctgataaccctaatgcggtcgccacagaatcgcctggcatggtgaagatcgat
gcgcccgggcatctcacaataaaccgtcaaagcatcgaagaccggatcggcatgaagttc
gatctccagcaaatccacatcaacctgatcaccttgtccggatatatcgacgaggatgac
gaacagttcacgctgagctggaaacactga

DBGET integrated database retrieval system