KEGG   Paraburkholderia aromaticivorans: CJU94_38170Help
Entry
CJU94_38170       CDS       T05169                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CJU94_38170
Enzymes [BR:parb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CJU94_38170
Transporters [BR:parb02000]
 Other Transporters
  Pores ion channels [TC:1]
   CJU94_38170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N_2 GST_N GST_N_3 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: ASW03977
UniProt: A0A248VYE2
LinkDB All DBs
Position
pBN2:386785..387390
Genome map
AA seq 201 aa AA seqDB search
MKLYYSPGACSLSPHIVLREMGLTFELEKVDLQSKKTESGSDFRSVNPNGYVPLLALDDG
QVLTEGPAIVQYLADRAPEARLAPEAGTMERYRLVEWLNFISTELHKAFAPLFNPKTPEE
WKAIVNDLIAARLAYVEKKLDGQAYLMGDNFTVADAYLFTVLSWGKWVGVDIGRWPTLQS
YTNRISSRPTVQAALRAEGLI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtactacagtcctggcgcttgttcgctttcaccgcacatcgtattgcgtgaa
atgggcttgacattcgagctcgaaaaagtcgatctgcaaagcaaaaagaccgagagcggt
tctgactttcgcagcgtcaaccccaatggttatgtgccgctgctggctctcgacgatggg
caggtgctcacggaaggtccggcgatcgtacagtacttggccgatcgggctcccgaagcg
cggctggcgcctgaagccgggacgatggagcgctatcgtttggtggaatggctaaacttt
atttcgaccgagcttcacaaggcttttgcgccgcttttcaatcctaaaacgccggaagaa
tggaaagccatcgtaaatgatttgatcgcggcgcgtctggcttatgttgaaaaaaagctc
gatggtcaggcctatctgatgggagataacttcacggttgctgatgcttatctgttcacc
gtgctgtcttggggaaagtgggtcggcgtagatatcggacgctggccgactttgcagagc
tatacgaatcgaatttcttctcgcccgaccgtgcaggccgcgctcagagccgagggcctg
atctaa

DBGET integrated database retrieval system