KEGG   Paraburkholderia aromaticivorans: CJU94_38640
Entry
CJU94_38640       CDS       T05169                                 

Definition
(GenBank) 2,3-dihydroxybiphenyl 1,2-dioxygenase
  KO
K14583  1,2-dihydroxynaphthalene dioxygenase [EC:1.13.11.56]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00626  Naphthalene degradation
parb01100  Metabolic pathways
parb01120  Microbial metabolism in diverse environments
parb01220  Degradation of aromatic compounds
Module
parb_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CJU94_38640
Enzymes [BR:parb01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.56  1,2-dihydroxynaphthalene dioxygenase
     CJU94_38640
SSDB
Motif
Pfam: Glyoxalase MutS_I
Other DBs
NCBI-ProteinID: ASW04048
UniProt: A0A248VYG6
LinkDB
Position
pBN2:complement(471536..472444)
AA seq 302 aa
MSKHAAVIELGYMGISVKDPEAWKSFAANMLGLQVLDQGEKDRFYLRMDYWHHRIVVHHN
GPDDLEYLGWRVAGKPEFEALGQKLIDAGYKIRVCDQAEAQERMVLGLMKTEDPGGNPTE
IFWGPRIDMNNPFHSGRPLHGKFVTGDQGLGHCIVRQTDVAAAHKFYSLLGFRGDVEYRL
PLPNGMTAELSFMHCNARDHSIGFGAMPAAKRLNHLMIEYTHMEDLGYTHQQFVRNKIDI
ALQLGIHSNDKALTFYGATPSGWLIEPGWRGATAIDEAEYYVGDIFGHGVEATGYGLDVK
LS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgagcaaacacgctgcagtcatcgagctcggatacatgggcatctcggtcaaggaccct
gaggcgtggaaatcatttgccgcgaatatgctgggcctgcaggtccttgatcagggtgag
aaggaccgtttctatctgcggatggattactggcatcaccgcatcgtggtccatcacaac
ggcccggacgacttggagtaccttggctggcgtgtggccggtaagccggaattcgaagct
ctgggtcaaaagctcattgatgccggctacaagatccgcgtctgcgaccaagccgaggct
caggaacgtatggtgctaggcctgatgaagacagaagatccgggcggcaacccgaccgag
atcttctggggaccccggattgacatgaacaacccgttccattccggtcgccccctgcac
ggcaagtttgtgaccggcgaccagggcttgggccattgtatcgttcgccaaaccgacgtc
gcggcggcccataagttctatagcctgctgggcttccgcggtgacgtcgaataccgcctt
ccgttgcccaacggcatgaccgctgaactgtcgttcatgcattgcaacgcccgtgatcac
tccattgggtttggtgccatgcccgcggccaagcgactcaatcacctgatgatcgagtac
acccacatggaagacttgggctacacgcaccaacagttcgtaaggaacaaaatcgacatt
gccttgcaacttggcattcactccaacgacaaggcgttaacgttctatggtgcaacgccc
tcgggctggctcattgagcccgggtggcgaggtgccacggccatagacgaagcggagtat
tacgtcggcgatatcttcggccatggcgtcgaggccaccggatatggcctggatgtgaaa
ctgagttaa

DBGET integrated database retrieval system