KEGG   Paraburkholderia aromaticivorans: CJU94_38645
Entry
CJU94_38645       CDS       T05169                                 

Definition
(GenBank) dehydrogenase
  KO
K00152  salicylaldehyde dehydrogenase [EC:1.2.1.65]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00626  Naphthalene degradation
parb01100  Metabolic pathways
parb01120  Microbial metabolism in diverse environments
parb01220  Degradation of aromatic compounds
Module
parb_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CJU94_38645
Enzymes [BR:parb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.65  salicylaldehyde dehydrogenase
     CJU94_38645
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: ASW04049
UniProt: A0A248VYD9
LinkDB
Position
pBN2:complement(472469..473920)
AA seq 483 aa
MNTKLFINNAWIDSSDKKTFARKHPVSDEVMTESANATVTDAIKAAQAAQEAFKSWKAVG
PSERRRLLLKVAEVMESKTPEFIEVMAKEVGASALWAGFNVHLSANVFREAASLATQIQG
ETIPTDKPDTLSMTLRQPVGPIVSIVPWNGTAVLAARAIAYPLVCGNTVVFKGSEFSPAT
HALITQCVQEAGLPAGVLNYLNSSPDRSPEIADALISAKEIRRINFTGSTRVGSIIAQKA
AQHLKRCLLELGGKSPLIVLDDADIDAAVKAAVFGSFLFQGQICMSTERLVVDEKIADEF
VAKFVEKTKRLSAGDPCVTGDCIIGPMVSPNSGERINGLFKDAIDKGAKVVCGGMAQGAV
MPATILDHVTSDMRIYDEETFGPITVVIRCKGEAEAIRIANDSAYGLSSGVFGRDVNRAL
RVGMAIQYGSVHINGSTVQNEAQAPYGGTKNTGYGRFDGRAVIDEFTELKWLTIEPFEQQ
YPF
NT seq 1452 nt   +upstreamnt  +downstreamnt
ttgaatacaaaactgttcatcaacaacgcctggatcgattcgagtgacaaaaagaccttc
gcacgcaagcaccctgtcagcgacgaggtgatgactgagagcgcaaacgccacggtgacg
gacgcgataaaggcggcgcaagcggcccaggaggctttcaagtcctggaaggccgttgga
ccttcggagcgtcgccgccttctgctgaaggtcgccgaggtcatggaaagtaaaacacct
gagttcatcgaagtgatggccaaggaggtgggagcctccgccctttgggccggcttcaac
gtccacctgtcagccaatgtgttccgggaagccgcctcgctggccacccaaatccagggt
gaaactatcccgacggacaagcccgacacgctctccatgacgctgcgtcagccagtcggg
ccgattgtgagcatcgttccatggaacggcacggcggtgctcgcagcgcgggccatcgct
tatccgctggtctgcggcaacacggtggtgttcaaaggctccgaattcagccccgcgacg
catgccctgatcacccagtgcgtgcaggaagccggcctgcccgccggcgtgctcaactac
ctcaactcttcgcctgaccgttcgcccgagatcgccgacgcactgatctccgccaaggag
atccgccgcatcaacttcacgggctccacccgcgtgggcagcattatcgcgcagaaggcc
gcgcaacacctcaagcgctgcctgctggagctcggcggcaagtccccgcttattgttctg
gacgatgcggacatcgacgcggcggtcaaggcagcggtgttcggtagcttcctgttccaa
ggtcagatctgcatgtccaccgagcgcttggtggttgatgagaagatcgccgacgaattt
gtcgccaagtttgtcgaaaagaccaagcgcttgagcgcgggcgacccatgcgtaactggc
gactgcatcatcggcccgatggtctcgccaaactcgggcgagcggatcaatggtttgttc
aaggatgcgatcgacaaaggggccaaagtcgtctgcggcggcatggcccaaggtgcggtc
atgccggccacgatcctggatcacgtcacatctgacatgcggatctacgacgaggagacc
ttcggtcccatcaccgtggtgatccgttgcaagggcgaagcagaggccatccgcattgcc
aacgacagcgcctatggcctgtcgtcgggcgtattcggccgcgacgtcaaccgtgctctg
cgcgtgggcatggcgatccaatacggttccgtccacattaacggctcgaccgtccagaac
gaggcacaggccccttacggcggcaccaagaacaccggctacgggcgcttcgacggccgc
gcggtgatcgacgagttcacagaactcaagtggctgaccattgaacctttcgagcagcag
tatcccttctaa

DBGET integrated database retrieval system