KEGG   Paraburkholderia aromaticivorans: CJU94_38650
Entry
CJU94_38650       CDS       T05169                                 

Definition
(GenBank) 3-(cis-5,6-dihydroxycyclohexa-1,3-dien-1-yl)propanoate dehydrogenase
  KO
K14582  cis-1,2-dihydro-1,2-dihydroxynaphthalene/dibenzothiophene dihydrodiol dehydrogenase [EC:1.3.1.29 1.3.1.60]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00624  Polycyclic aromatic hydrocarbon degradation
parb00626  Naphthalene degradation
parb01100  Metabolic pathways
parb01120  Microbial metabolism in diverse environments
parb01220  Degradation of aromatic compounds
Module
parb_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CJU94_38650
   00624 Polycyclic aromatic hydrocarbon degradation
    CJU94_38650
Enzymes [BR:parb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.29  cis-1,2-dihydro-1,2-dihydroxynaphthalene dehydrogenase
     CJU94_38650
    1.3.1.60  dibenzothiophene dihydrodiol dehydrogenase
     CJU94_38650
SSDB
Motif
Pfam: adh_short_C2 adh_short NmrA NAD_binding_10 Epimerase
Other DBs
NCBI-ProteinID: ASW04050
UniProt: A0A248W0A5
LinkDB
Position
pBN2:complement(473969..474748)
AA seq 259 aa
MSTQQVVAITGASSGIGLELVRSFKAAGYCVSALVRNEGQEAGLRREFKDTLQIVVGDVR
EHAVNEKLVKQTVDKFGHLDCFIANAGIWDYMLSIEEPWEKFAGSFDELFNINVKSYFSG
ISAALPELKKTNGSVVVTASVSSFAVGGGGSGYIASKHAVLGMVKALAYELAPHIRVNGV
APGGTVTSLSGSASAGFDKTQMKDMPGIDEMIKGLTPLGFAAKPEDVVAPFLLLASREQG
KFITGTVISIDGGMALGRK
NT seq 780 nt   +upstreamnt  +downstreamnt
atgagcacacaacaagttgttgccatcaccggtgccagttccggcatcggcctcgaacta
gtccgatctttcaaagccgccgggtattgcgtatccgctctcgttcgcaatgaggggcag
gaggcgggccttcgccgtgaattcaaagacaccctgcagattgtggtgggcgatgttcgg
gagcacgcggtgaatgagaagttagtgaagcagacggtcgacaagtttggtcacctcgat
tgcttcatagcaaacgccggtatctgggattacatgttgagtatcgaggagccctgggag
aaattcgcgggtagctttgatgaactcttcaatatcaatgtcaagagctatttcagcggc
atcagcgctgccttgccggagctgaaaaagaccaacggatcggtggtggtgaccgcttcg
gtctcgtcctttgcggtcggtggtggtggttctggctacatcgccagcaagcatgcggta
ttgggcatggtcaaggcgctggcctacgaactggctccgcatattcgggtcaatggcgtt
gcgccaggtggcaccgtcacttcactgtctgggtctgcaagcgccggattcgacaagacc
caaatgaaagacatgccaggcatcgacgaaatgatcaaaggcctcacgcctttgggattt
gcagccaagccagaagacgtggtcgccccctttctgttgctggcttcgcgtgagcaaggg
aagttcattaccggcaccgtgatcagcatcgacggcggcatggcactcggacgcaagtga

DBGET integrated database retrieval system