KEGG   Paraburkholderia aromaticivorans: CJU94_39035
Entry
CJU94_39035       CDS       T05169                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00362  Benzoate degradation
parb01100  Metabolic pathways
parb01120  Microbial metabolism in diverse environments
parb01220  Degradation of aromatic compounds
Module
parb_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CJU94_39035
Enzymes [BR:parb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     CJU94_39035
SSDB
Motif
Pfam: ECH_1 ECH_2 DUF4351
Other DBs
NCBI-ProteinID: ASW04160
UniProt: A0A248W0N8
LinkDB
Position
pBN3:complement(59079..59855)
AA seq 258 aa
MQEQPVVVETVDRVGVITLNRPKQMNALNDALMDALGVALLGFDADDGIGTIIITGNAKA
FAAGADIAAMAGWSYMDVYRSDFITRNWETIRRVRKPVIAAVAGVVMGGGCELALACDIV
IAADSARFALPEVKLAMLPGAGGTQRLPRAIGKAKAMDMCLSARTMDSAEAERSGLVSRV
VAAEALLDENMALAARIASYSLPALMAIKESVNRAYESSLCEGVLFERRQLHARFASVDA
REGMTAFLDKRQPVFSHR
NT seq 777 nt   +upstreamnt  +downstreamnt
atgcaggaacaaccggtcgtcgttgaaacggtggatcgggtcggtgtcatcacgctgaac
cggccaaaacagatgaatgcgcttaacgacgcgctgatggacgcattaggcgttgcgctg
ctgggcttcgatgccgatgacggtattggtaccatcatcattaccggcaatgcgaaggcc
ttcgcggcgggcgctgatattgccgccatggcgggctggtcctacatggacgtgtaccga
agcgatttcatcacccgtaactgggaaaccatccgtcgcgtgcgcaagcccgtgatcgcg
gccgtcgcgggcgttgtcatgggcggcggttgcgaactcgcgctcgcctgcgacatcgtc
atcgccgccgatagcgcccggtttgcgctgcccgaagtgaagctggccatgttgccgggc
gcgggcggtacgcagcggctgccgcgcgccatcggtaaggccaaggcgatggacatgtgc
ctgagcgcgcgcacgatggactccgctgaagcggagcgcagcggactggtctcgcgcgtg
gtcgcagccgaagcgctgcttgacgaaaacatggcgctggctgcgcgcatcgccagctac
tcgctgcccgcgctgatggcgatcaaggaatcagtcaaccgcgcctacgaatcctcgctc
tgcgagggtgtcctgttcgagcgccgccagttgcatgcgcgctttgccagcgttgacgcg
cgtgaaggcatgactgcctttctcgacaaacgccaacccgtgttcagtcatcgctaa

DBGET integrated database retrieval system