KEGG   Parabacteroides sp. CT06: CI960_13345Help
Entry
CI960_13345       CDS       T05011                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
parc  Parabacteroides sp. CT06
Pathway
parc00564  Glycerophospholipid metabolism
parc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:parc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CI960_13345
Enzymes [BR:parc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CI960_13345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 HI0933_like Pyr_redox_2 GIDA Pyr_redox Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AST54256
UniProt: A0A223HP68
LinkDB All DBs
Position
complement(3087581..3089146)
Genome map
AA seq 521 aa AA seqDB search
MDRSKMISQLEDPSEVFDFLVIGGGATGIGIALDASTRGYRVALFEQSDFTKGTSSRSTK
LVHGGVRYLAQGDVSLVLEALRERGLLRQNAPHLVKDQTFLIPCYRWWEGPFYTIGLILY
DVMAGKLGLGRSVCIGPKRALRTIPMLRPKGMTAGVLYHDGQFDDSRLAINMVRSSIDAG
ACILNYAKVIGLLKDGDRKVSGVTVRDEETGTVYQVRSRCVINATGVFADEILQMDEPGK
RPTVRPSQGVHLVLDSSFLQSDCAIMIPKTSDGRVLFAVPWHDKVVVGTTDTLMESPEKE
PVALEKEIQFILDTAANYLTRPPKRSDVLSVFAGLRPLAAPRSEGKKTKEISRSHKLIRE
KSGLITIIGGKWTTYRKMAQDTLDLAIRYMHIPTKDCITERYQIHGSRKNPDFSDPLYVY
GTDADEIRNLVASSPAMAEKLHPDYAYTVGEVTWLVRNEMPRTLEDVLARRLRILFLDAR
AAMAMAPKVAGILATEWGKDETWTSAQVKAFNEVASNYILN
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtagtaaaatgatttctcagttggaagacccgtctgaagtctttgattttctt
gtgatcggaggaggagctaccggcataggtatcgctctggatgcttcgacaagaggatat
agagtcgccttattcgaacaatcggactttacgaaaggaacttccagccgtagtacgaag
ttggtccatggcggtgtccgttatttggcgcaaggagatgtctccttggttctggaagct
ttgcgcgaacgaggcctgctacgccagaacgctccccatttggtaaaagatcaaaccttc
ttaatcccttgttatcgttggtgggaaggcccgttttatacgataggcctgatcctatat
gatgtgatggccggaaaattaggtctgggacgttcggtttgtatcggtccgaaacgggcg
ctccgtaccattccgatgcttcgtccgaaagggatgaccgccggggtgctttatcacgac
ggccagttcgatgattcccgccttgcgattaatatggtccgcagctctatcgacgctggc
gcttgtatcttgaactatgcgaaagtcatagggcttctgaaggatggcgaccgcaaagta
tccggcgttacggttcgagatgaggagaccggtacggtttatcaagtaagatcccgttgc
gtgatcaatgctaccggtgtcttcgccgatgagatcttgcaaatggacgagccgggtaaa
cgcccgaccgttcgccccagccaaggagtccatttggtattggattcctctttcttgcaa
agtgattgcgccattatgattcctaagacatcggatggacgtgtgttgttcgccgtacct
tggcatgataaagtcgtggtagggacaacggataccttgatggaatcgccggaaaaggag
ccggtagccttagagaaagaaatccaatttatactcgatacggccgctaattatttgacc
cggccacccaagcgaagcgatgtcttatccgtgtttgcggggcttcgtccgctcgccgct
ccccgtagcgaaggtaaaaagacaaaagagatatcacgtagccataaattgatccgggag
aaatccggcttgatcaccattatcggaggcaaatggacaacctaccggaaaatggcccaa
gataccctagacctagcgatacgttacatgcatattcctacaaaagattgtattaccgag
cgttaccaaatccatggtagccggaagaatccggatttctccgatcctttatacgtatat
ggtacggatgccgacgaaatccgtaacttagtggcctcttcccccgccatggcggagaag
ttgcatccggactatgcctatacggtaggagaggtaacttggctggtccgtaatgagatg
cctcgtactttggaggatgtattggcccgccgtttgcgtatcttattcttagacgcacgg
gcggcgatggcgatggctcctaaagtagcggggattctggctacggaatgggggaaggac
gagacttggacctctgctcaggtaaaggcgtttaatgaggttgcctcgaattatatactg
aattga

DBGET integrated database retrieval system