KEGG   Parabacteroides sp. CT06: CI960_17545Help
Entry
CI960_17545       CDS       T05011                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
parc  Parabacteroides sp. CT06
Brite
Translation factors [BR:parc03012]
 Eukaryotic Type
  Elongation factors
   CI960_17545 (tuf)
 Prokaryotic Type
   CI960_17545 (tuf)
Mitochondrial biogenesis [BR:parc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CI960_17545 (tuf)
Exosome [BR:parc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CI960_17545 (tuf)
  Exosomal proteins of breast cancer cells
   CI960_17545 (tuf)
  Exosomal proteins of colorectal cancer cells
   CI960_17545 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW Vps39_1
Motif
Other DBs
NCBI-ProteinID: AST55029
UniProt: A0A223HRH1
LinkDB All DBs
Position
complement(3947266..3948453)
Genome map
AA seq 395 aa AA seqDB search
MAKEKFDRSKPHVNIGTIGHVDHGKTTLTAAITTVLAKKGLSELRSFDSIDNAPEEKERG
ITINTSHVEYQTANRHYAHVDCPGHADYVKNMVTGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVNVPRLVVFMNKCDMVDDEEMLELVEMEMRELLSFYQFDGDNTPIIRGSALGALN
GDAQWEDKVMELMEACDTWIPLPPREIDKPFLMPVEDVFSITGRGTVATGRIETGIVKVG
EEVQIIGLGAAGKKSVVTGVEMFRKLLDQGEAGDNVGLLLRGIDKNEIKRGMVICHPGQV
KEHSKFKAEVYILKKEEGGRHTPFHNKYRPQFYIRTLDVTGEITLPEGTEMVMPGDNVTI
EVELIYPVACSVGLRFAIREGGRTVGAGQITELEN
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagagaaatttgacagatcgaaaccacatgtgaacattggtacgattggtcac
gttgaccacggtaaaacaactttgacagctgctatcacaacagtattggcaaagaaaggt
ctttcagagttgcgttcattcgattctatcgacaacgctcctgaagaaaaagagagaggt
atcacaatcaacacttctcacgtagagtatcagactgcaaaccgtcactatgctcacgta
gactgtccgggtcacgccgactacgtaaagaacatggtaactggtgctgctcagatggac
ggtgctatcatcgtagttgctgctactgatggtcctatgcctcaaactcgcgagcacatc
cttttggctcgtcaggtaaacgttccgagattggttgtattcatgaacaagtgtgacatg
gttgacgacgaggaaatgttggaattggttgagatggagatgagagagttgctttcattc
tatcaattcgacggtgacaacactccgatcatccgtggttctgctcttggtgcattgaac
ggtgatgctcaatgggaagataaagtaatggagttgatggaagcttgtgatacttggatt
cctctgcctccgcgcgaaatcgacaagccgttcttgatgccggttgaggacgtattctca
atcacgggtcgtggtactgttgctacaggtcgtatcgagacaggtattgttaaggttggt
gaggaagttcagatcatcggtcttggcgctgctggtaagaaatctgttgttacaggtgtt
gagatgttccgtaagttattggatcaaggtgaggctggtgataacgttggtttgttgctt
cgcggtatcgataagaatgagatcaagcgtggtatggtaatctgccacccgggtcaggtt
aaagagcattctaagttcaaggctgaggtttatatcttgaagaaagaggaaggtggtcgt
cacactccgttccacaacaaatatcgtcctcagttctatatccgtacattggatgtaact
ggtgagatcactttgccggaaggaactgaaatggtaatgccgggtgataacgtaacgatc
gaggttgagttgatctatccggtagcatgtagcgtaggtcttcgtttcgctatccgcgag
ggtggacgtacagtaggtgcaggccagatcacagaattagagaactaa

DBGET integrated database retrieval system