KEGG   Parabacteroides sp. CT06: CI960_20965Help
Entry
CI960_20965       CDS       T05011                                 

Definition
(GenBank) sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
parc  Parabacteroides sp. CT06
Pathway
parc00511  Other glycan degradation
parc00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:parc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    CI960_20965
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CI960_20965
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:parc02042]
    CI960_20965
Enzymes [BR:parc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CI960_20965
Bacterial toxins [BR:parc02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CI960_20965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_assoc_N BNR_3 BNR_2 BNR Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: AST55634
UniProt: A0A223HT71
LinkDB All DBs
Position
4803079..4804704
Genome map
AA seq 541 aa AA seqDB search
MKKTFLYFCLLFIVQTAFAADSLYVREQQIPILIDRIDNVLYEMRIPAQKGDVLNEITIQ
IGDNVDLSDIQAIRLFYSGVEAPSRKGEHFSPVTYISSHIPGNTRKALESYSVRQDEVSA
PLSRTVKLTSKQPMLKGINYFWVSIQMKPETSLLAKVATTMPNAQINNKPIDITWKGKVD
ERHVGIGVRQAGDDGSAAFRIPGLVTTNNGTLLGVYDIRYNSSVDLQEKIDIGVSRSTDK
GQTWEPMRVAMTFKQTDGLPHGQNGVGDPSILVDEKTNTIWVVAAWTHGMGNERAWWNSM
PGMTPDETAQLMLVKSEDDGKTWSEPINITSQVKDPSWYFLLQGPGRGITMQDGTLVFPI
QFIDATRVPNAGIMYSKDRGKTWHLHNLARTNTTEAQVAEVEPGVLMLNMRDNRGGSRAV
ATTKDLGKTWTEHPSSRSALQESVCMASLIKVNAKDNITGKDLLLFSNPNTTKGRNHITI
KASLDGGLTWPTEHQVLLDEAEGWGYSCLSMIDKETVGIFYESSVAHMTFQAIKLQDIIH
Q
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaactttcctgtatttctgccttcttttcatcgtacaaacggcttttgcggca
gacagtctttatgtgcgagagcaacaaatccccatcttgatagaccggatcgacaatgta
ctttacgagatgcggataccggcccaaaaaggggatgtattaaacgagatcacgatacag
atcggagacaatgtcgacctgtcggacatccaagcgatacgtctattttatagcggagtg
gaagctccatcccgcaaaggggaacatttcagtcccgttacgtacatatccagccatata
ccgggaaatacccgtaaggctcttgaatcttattccgtacggcaagatgaggttagcgcc
cccttgtcgcgcacggtaaaactaacctctaagcaaccgatgcttaaaggcatcaactat
ttctgggtaagtatccagatgaagccagagacttccttattggcaaaagtagcgaccacg
atgcctaacgcacagatcaacaacaaaccgatcgacatcacttggaaaggaaaggtggac
gaacgccatgtaggtatcggcgtacgccaagccggggatgacggatcggcggccttccgc
atcccgggattagtgacgacgaataacggaacattacttggagtctacgatattcgctat
aatagcagcgtggacctgcaagagaaaatcgatatcggagtaagccgcagtaccgataag
ggacaaacttgggaaccgatgcgagtagccatgactttcaaacaaacggatggcctgccc
cacggacaaaacggcgtgggagacccatcgatcttggtagacgaaaagaccaatacgatc
tgggtagtagccgcgtggacgcatggtatgggtaacgaacgggcttggtggaactccatg
ccgggaatgacaccggacgagaccgcccaacttatgctcgtgaaaagtgaggacgatggt
aagacgtggagcgaaccgatcaatatcacctcccaagtaaaagacccgtcttggtatttc
ctattgcaaggcccgggacgaggcatcacgatgcaagacggtaccttggtcttcccgatc
cagtttatcgacgctacccgtgtgcccaacgccggcattatgtatagcaaagaccgcggg
aaaacatggcacctgcataacttagcccgcacgaataccacagaggcgcaagttgccgag
gtagagccgggcgtattgatgttaaatatgcgtgataaccggggcggtagccgtgccgtg
gccaccacaaaggatttaggcaagacatggacagagcatccttccagccgtagcgcctta
caggaatccgtttgtatggccagcttgatcaaggtaaacgccaaggataacatcaccggc
aaggaccttctactcttctccaatccgaacacgacgaaagggcgtaatcatatcacgatc
aaggcgagtctggacggtggacttacttggcccacggagcatcaagtcttattagacgag
gccgaggggtggggatattcctgtctttcgatgatcgataaggaaacggtaggaatcttc
tacgagtcaagcgtagcacatatgaccttccaagctatcaaattacaggatatcattcat
caataa

DBGET integrated database retrieval system