KEGG   Parabacteroides sp. CT06: CI960_21710Help
Entry
CI960_21710       CDS       T05011                                 

Definition
(GenBank) glycoside hydrolase family 2
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
parc  Parabacteroides sp. CT06
Pathway
parc00052  Galactose metabolism
parc00511  Other glycan degradation
parc00600  Sphingolipid metabolism
parc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:parc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CI960_21710
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    CI960_21710
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CI960_21710
Enzymes [BR:parc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CI960_21710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_N Glyco_hydro_2_C DUF4982 Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: AST55773
UniProt: A0A223HTL0
LinkDB All DBs
Position
4990620..4993148
Genome map
AA seq 842 aa AA seqDB search
MNRPLAWLLGLLLTACSPAGEQVRERSSWNDDWKFALSDSVQDYSSPDSDDSTWRILSLP
HDWSIEGDFSLDNPSTPGGGALPGGIGWYRKTFTLPETDRDKVIYVDFDGVYRNSEVWIN
GHSLGFRPNGYVSFRYDLTPYLRYGSQPNVIAVKADNSEQPNSRWYSGSGIYRNVWLVKV
NPVHVDNWGTFVHDMKISSEEATFALEVRIRNSSEADREAEVSTSIYDDRNKVVTASVTT
LLRVPYTPCYDTRMREASVDHQFSIPNPKLWSPDSPSLYTAVTEVKVAGKVVDRYETVFG
LRTFRWDSATGFYLNDKPLKIKGVCLHHDLGCLGAAVNTRAIERQLRIMKEMGANAIRTS
HNAPAPELLDLCDRMGLLVQDESFDMWERRKSPYDYARYFAEWHERDLTDEILRDRNHAS
VFMWSIGNEVLEQWSHADATELDLQAANLILNAGHAIDPALLKDTTLSRQSLITRHLAGI
VKRLDTSRVVTAGCNEVNPANHLFRSDALDVLGFNYHERYFEPFLRNFPGKKLIVSESTS
ALMTRGYYEMPSDHIYIRPESWDKPFEAPEHVCSSYDNCHVPWGSTHEKTWHLVKTLPHV
SGLFVWTGFDYLGEPTPYWWPSRSSFFGIVDLAGFPKDVYYMYKSEWTDEPVLHIFPHWN
WKVGEPVDIWAYYNNADEVELYLNGKSLGVQQKTDSTYHVSWRVPFTPGTLRAVSRLGGK
EVLVKEIHTAGEPARLVLTPDRSVIQADGSDLSFVTVDVCDIDGNRVPDATPLIRFFVEG
PGEIAGTDNGDPNDPNSLRKPKRQAYYGKALVVIRNKGGQGDIHLKAIAEDLPEATVTIQ
AQ
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggccacttgcgtggcttctgggcctattgctcaccgcctgttcccccgctggg
gagcaggtgcgtgaacgtagctcatggaatgacgattggaagtttgccttgtcggatagc
gttcaggattattcatccccggacagcgatgattccacttggcgtatcttatccttaccg
catgattggagtatcgagggggatttctccctcgacaacccgtctaccccgggtggcggt
gcgctaccgggcgggattggttggtaccgaaagacatttaccctgccggagacggatcgg
gataaggttatctatgtggatttcgacggggtctaccggaatagcgaggtctggatcaat
ggtcattcgctgggattccgcccgaatggttatgtatcgtttcgttatgacttgacgcct
tatttgaggtatggaagccaaccgaacgtgatcgccgtgaaggcggataatagcgagcaa
ccgaactcccgctggtattccggctccggtatctaccgtaacgtatggttagtaaaggtg
aatccggtgcatgtggacaactggggcactttcgtgcatgatatgaagatctcatcggag
gaggccacattcgccttggaggtgagaataaggaatagctcggaggcggatagggaggcc
gaagtctctacctctatttacgatgaccgtaataaagttgttacggcatccgtaacaact
ctgttacgggtaccgtatacgccctgttacgacacccgtatgcgggaggcatctgtcgat
catcagttctcgatcccaaatcccaagctttggagtcccgattctccctcgctctacacg
gccgtcacggaagtgaaagtggccggcaaggtggtagaccgttatgagacggtattcgga
ttgcgtacgttccgttgggattccgctaccggcttttatttgaatgataagcctttgaag
ataaaaggggtttgcctgcatcatgacttaggctgtctgggtgccgccgtgaatacacgg
gctatcgagcgccagctgcggatcatgaaggagatgggagcgaacgcgatccgtaccagc
cataacgccccggcacccgagttgctggatctttgcgatcgtatggggcttctggtacag
gatgagtctttcgatatgtgggaacgccgtaagtccccgtacgattacgcccggtatttc
gcggagtggcacgagcgggatttgacggacgagatcttgcgtgaccggaatcacgcctct
gttttcatgtggagtataggcaatgaggtgcttgagcaatggagccatgccgacgctacc
gagctggatctgcaagcggcgaacctgatcttgaatgccggccatgccatcgatcccgct
ttgctgaaggatacgacccttagccgtcaatccttgatcacccgtcatttggcgggtatc
gtgaaacgtctggatacctcccgggtcgttaccgccggctgtaacgaggtaaacccagcg
aatcatctgtttcgctcggatgccttggacgtgctgggcttcaactaccatgagcgatat
ttcgagccgtttctccggaatttccccggaaagaaactgatcgtgagcgaatctacctcg
gccttgatgacccgtggctattatgagatgccgtccgatcatatttatatccgtccggaa
tcgtgggacaagcctttcgaggctcccgagcatgtttgctcctcttatgataattgccat
gtaccttggggctctacgcacgagaagacttggcatctggtgaagacgcttccgcatgta
tccggcctgttcgtctggacgggtttcgattacttgggagagcctaccccctattggtgg
cccagccggagcagcttcttcggtatcgtggatctggcgggtttcccgaaagatgtatat
tatatgtataaaagcgagtggacggatgaacccgtattgcacattttcccgcattggaac
tggaaggtaggcgaaccggtggatatctgggcctattataacaatgccgatgaggtagaa
ctatacctaaatggaaagagcctaggcgtacaacaaaaaacggacagtacctatcatgtc
tcttggcgtgtgcctttcacgcccggaaccttgagagccgtctcccgcttagggggtaag
gaggtcttggtgaaagagatccatacggcaggagagccggcccgtttggtcttgacaccg
gatcgtagcgtcatccaagcggatggctcggacctatcgtttgtaaccgtagatgtatgc
gatatcgatggtaaccgggttcccgacgctactccattgatccgtttcttcgtggagggc
ccgggtgagatcgccggaacggataacggagatccgaacgatccgaacagcctccgtaaa
ccgaaacggcaagcctactacggaaaagccttggtcgtgatccggaacaagggcggacaa
ggcgacatccacttaaaagccatagccgaggacttacccgaggcgacggtaacgattcaa
gcgcaataa

DBGET integrated database retrieval system