KEGG   Parabacteroides sp. CT06: CI960_22960Help
Entry
CI960_22960       CDS       T05011                                 

Definition
(GenBank) 2,6-beta-D-fructofuranosidase
  KO
K03332  fructan beta-fructosidase [EC:3.2.1.80]
Organism
parc  Parabacteroides sp. CT06
Pathway
parc00051  Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:parc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CI960_22960
Enzymes [BR:parc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.80  fructan beta-fructosidase
     CI960_22960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N DUF4980 Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: AST56006
UniProt: A0A223HU91
LinkDB All DBs
Position
5330298..5332106
Genome map
AA seq 602 aa AA seqDB search
MKQQTKRLLKSLCMAVGIILLSAVDPLAGYAAERTIDIKHLGEGQSIVRVDARAKYLLLP
VEESSPESKLYMIVDNDVVRTFNVRLAVNKVDYFVPVDLSGYADKHISFNFQLAPESALC
WKEMKLSDQFDSSNREKFRPAYHFSPAWGWMNDPNGMVYKDGEYHLFYQYNPYGSMWGNM
HWGHAISKDLIHWEHQPVAIAPDALGTIFSGSCVVDKDNTAGFGAGAIVAFYTSASDRQV
QSMAYSLDNGRTFKKYDRNPILTSTQRDFRDPKVFWHKESNKWIMVLAVGQEMQLYSSPN
LKDWTYESSFGEGQGAHAGVWECPDLIELPVKGTELKKWVLICNINPGGPFGGSATQYFV
GAFDGKQFVNESPALTKWMDYGKDHYATVTWSNAPEDRKIALAWMSNWEYANNVPTLQYR
SANSVPRDLVLYTKNGQTYLSSTPSPEVLKLRGKAQKKGSFKVDRSHEVNPVLPDPTGTY
EIEIKFKNNGADIMSFQLFNSKGEEVEMRYNLLDNTFTMDRRNSGITDFSKTFATATSAP
ISAAKEYTLRLLVDKSSIEAFDGNGEFVMTNLVFPEEPYNRISFHAKGGAFTVTSLTIYP
FK
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacaaacaaagagacttctgaagagtttatgtatggctgtcggtatcatttta
ttgagcgcggtcgatccgttggccggatatgcggcagaacgtactatagatataaagcat
ctgggcgaagggcaaagcattgtccgtgtggatgcgcgagccaaatatttgttgcttccg
gtcgaggagtcctcgccggaatccaagttgtatatgattgtcgataatgacgtggtacgg
actttcaatgttcgtttggcggtgaataaggtggattatttcgttccggtagatctctcg
gggtatgcggataagcatatctccttcaacttccagcttgccccggaatcggctctttgc
tggaaagagatgaagctatccgatcagtttgattcgtctaaccgggagaaattccgtccg
gcctatcatttctcgccggcttggggatggatgaatgatccgaacggcatggtgtacaag
gatggtgagtatcatttgttctatcaatacaatccgtatggctcgatgtgggggaatatg
cactgggggcatgcgatcagcaaggacttgattcattgggagcatcaaccggtggcgatc
gccccggatgccttgggtacgatcttcagcggtagctgtgtggtggataaggataatacc
gcggggtttggcgctggcgctatcgtggctttctatacctcggccagcgaccggcaagtg
cagagtatggcctatagcttggacaacggccgaacgttcaagaaatatgaccggaatccg
atccttacttctacgcaacgtgatttccgtgacccgaaagtcttctggcataaggaatcc
aataaatggatcatggtactcgccgtagggcaggagatgcaactctattcttctcccaat
ttgaaggactggacgtatgagagcagtttcggggaaggacaaggagcgcatgcgggcgtt
tgggaatgcccggacttgatcgagcttccggtgaagggcacggaattgaagaagtgggtc
ttgatctgtaatatcaaccccggtggtccgtttggcggctccgctacccaatatttcgta
ggtgcgttcgatgggaaacagttcgtgaatgaatccccggccttgaccaaatggatggat
tacggcaaggatcattacgctacggtaacttggagtaacgccccggaggaccggaagatc
gccttggcttggatgagcaattgggaatacgcgaataacgtgccgaccttgcaataccgg
agtgcgaattcggttcctcgcgacttggttctttatacgaaaaacgggcagacgtacttg
agcagcaccccgtctcccgaggtgttgaagttgagagggaaagcccagaagaaaggttcc
ttcaaggtggaccgctcccatgaggtcaatccggtacttcccgatccgacgggaacctat
gagatcgagatcaagtttaagaacaacggggccgatatcatgagcttccagctgtttaac
tcgaaaggcgaggaggtggagatgcgttataatcttctggataatacgttcacgatggat
cgccgtaacagcgggatcacggatttcagcaagacattcgccacggctacctcggccccg
atctccgccgctaaggaatataccttgcgtttgctggtagataaatccagcatagaggct
ttcgacgggaatggggagtttgtcatgaccaacctagtcttcccggaagaaccgtataat
cgcattagctttcatgccaagggaggagcgttcacggttacgtcattaaccatttatccc
ttcaaataa

DBGET integrated database retrieval system