KEGG   Parabacteroides sp. CT06: CI960_23015Help
Entry
CI960_23015       CDS       T05011                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
parc  Parabacteroides sp. CT06
Pathway
parc00473  D-Alanine metabolism
parc01100  Metabolic pathways
parc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:parc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CI960_23015
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CI960_23015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:parc01011]
    CI960_23015
Enzymes [BR:parc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CI960_23015
Peptidoglycan biosynthesis and degradation proteins [BR:parc01011]
 Precursor biosynthesis
  Racemase
   CI960_23015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AST56017
UniProt: A0A223HUK3
LinkDB All DBs
Position
complement(5346880..5349345)
Genome map
AA seq 821 aa AA seqDB search
MEYAIKEIARVIGAKTNQLLDDTVSLLLTDSRRLSFPEKSLFFALKTKTNDGHRYIQELY
KLRVRNFVVSDMLPEFESMKDANFLIVKDTLRALQKLATHHRKQFNIPVIGITGSNGKTI
VKEFLYQLLHNEFNIVRSPRSYNSQLGVPLSVWQMSEKNTLGIFEAGISQPDEMERLQPI
IAPTIGIITNIGEAHQENFLSSNQKCMEKLTLFNDCEAIIYDGDDLFIANCIESACLSHK
AIAWSRTDSEAPLFIESIDKKEFETIIHCTLLGFNRVVTIPFTDDASIENVIHCMAVMLY
LKPTSVNDVTKFLHLEPVAMRLDVKQGINNCLLINDTYNSDINSLDIALDFQQSRRVGKQ
LKSTLILSDILQSGTLPKSLYKKVADLVRRKKIDRIIGIGRDLKEYASVFEIEKEFYTTT
EEFIKSPSFKKFKDELILIKGSRHFHFEQISELLEKKVHETILEVNLDAIVHNFNQYRSK
LKPETKMVCMVKAFGYGAGSYELAKTLQEHRCDYLAVAVADEGAELRKEGISIPIIVMNP
EFSSFNVLFENHLEPEVYSFRLLDAMIRETERRGITSYPIHIKIDTGMHRLGFQPEDVPA
ICERLRAQSGVIARSVFSHLAGSDSYVFDDFTHQQLDKFTKAAGELESGLEYKVIKHILN
SAGIERFAAYQMDMVRLGIGLYGVSASGQKGLRNVSTLKTTILQIQNVPAGDSIGYSRMS
YVKRDSRIAIIPIGYADGLDRHFSNGGGEVLINGQRCPIIGNICMDACMIDVTDIHAQEG
DAVIIFGDELPVSELSDKLKTIPYEILTSISPRVKRVYFRE
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggaatacgcaattaaagaaatagcaagagttatcggtgctaaaacaaaccaattgctt
gacgatacggtcagtttattgttgactgacagccgtcgtctctccttcccggaaaaaagc
ctcttcttcgccttgaaaaccaagacgaacgacggacatagatatatacaggaactctat
aaacttcgtgttcgcaacttcgtggtaagcgatatgctaccggagttcgagagcatgaag
gacgcaaacttcctgatcgtaaaagatacgttacgagctttacaaaaactggcgactcac
cacaggaagcaattcaacatccccgtgatcggcatcaccggtagcaacggaaagacgatc
gtaaaggaattcctctatcaactgttgcataacgagttcaacatcgtacgttcgcctcgg
agctacaactcccagttgggggttcctctctcggtatggcagatgagcgagaaaaataca
ctgggcatcttcgaggccggtatctcacaaccggacgagatggaacgcctgcaacccatt
atcgcccccacgatcggtatcatcacgaatatcggggaggctcatcaagagaatttcctc
tcctccaatcagaaatgtatggagaagctgacgcttttcaatgattgcgaagccattatt
tatgatggggatgatttatttatcgccaattgtatcgaatcggcttgcctttctcataaa
gcgatcgcatggagccgtacggactccgaggctcctttgtttatcgagtctatcgataag
aaagagtttgagacgatcattcactgtactttactgggcttcaaccgggtcgttaccatt
ccgttcacggacgacgcttctatcgagaacgtgatccattgtatggcggttatgctttac
ctaaaacccaccagcgtaaacgacgtaacaaaattcttgcatcttgagccggtggctatg
cgattggacgtaaagcaaggtatcaacaattgcctgttgataaatgatacctataactcg
gatatcaactccttggatatcgcgctcgatttccaacaaagccgccgggtaggcaagcaa
ttaaagagcactttaatcctctccgatatccttcaatcgggcaccttgccgaaatctcta
tataagaaggtcgccgatttggttcgccgtaagaagatagatcgtatcatcggtatcggc
cgcgacttaaaggaatatgcttccgtcttcgagatcgagaaggagttttacacgaccacc
gaggaatttatcaagtctccttccttcaagaaattcaaggatgagttgatcttgattaaa
ggttcccgccatttccatttcgagcagatctccgagttgttggagaagaaagtgcatgag
acgatcctagaggtaaatctggacgcgatcgtacacaacttcaatcagtatcgttccaag
ctaaagccggagactaagatggtttgtatggtaaaagcttttggttatggagccggctct
tacgagttggcgaagacccttcaagaacatcgttgcgactatctggccgtggcggtagcc
gacgagggagccgaattgcgtaaagaaggcatctcgatccccattatcgtcatgaatccg
gaattcagcagtttcaatgtcttgttcgagaaccatctggaaccggaagtctatagcttc
cgcctattggatgccatgatccgggagaccgagcgcagagggatcacctcttaccctatc
catatcaagatcgataccggcatgcatcgcctagggtttcaaccggaggatgtcccggcg
atctgtgaacgcttgagagcgcaatccggggttatcgcccgttcggtcttctctcattta
gccggaagcgactcgtacgtcttcgatgattttacccatcaacaattggataaattcacc
aaagccgcaggggaactagaaagcgggttagagtataaggtaatcaaacatatcctaaac
tccgcgggaatcgagcgtttcgccgcttatcaaatggatatggtacgtttaggtatcggt
ttatatggagtaagcgcatccggacaaaaaggcttacggaatgtcagcaccttgaagaca
acgatcttacaaatacaaaacgtacccgcaggggattcgatcggttatagccgtatgagt
tatgtgaaacgtgattcccggatcgctatcatcccgatcggatacgccgacggactggat
cgccacttcagcaacggaggtggggaggtcttgatcaatggacaacgctgtccgattatc
ggcaacatctgcatggacgcttgcatgatcgatgtcaccgacatccatgcgcaagaaggc
gacgccgtaattattttcggcgacgaactaccggtgagcgaactttcggataaactgaaa
acaatcccttatgagatattaacctctatctcgcctcgggtaaagagggtttatttccgg
gaataa

DBGET integrated database retrieval system