KEGG   Paracoccus sp. BM15: CUV01_05670
Entry
CUV01_05670       CDS       T05237                                 

Definition
(GenBank) type VI secretion system contractile sheath small subunit
  KO
K11901  type VI secretion system protein ImpB
Organism
paro  Paracoccus sp. BM15
Brite
KEGG Orthology (KO) [BR:paro00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paro02044]
    CUV01_05670
Secretion system [BR:paro02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CUV01_05670
SSDB
Motif
Pfam: T6SS_VipA DUF4911
Other DBs
NCBI-ProteinID: AUH32950
UniProt: A0A2K9EDD8
LinkDB
Position
complement(1133950..1134474)
AA seq 174 aa
MAADKSTDFIKRNRPPRVNISYEDPYDSEKMVELPFVMGVMSDLSGNASPVDKEAMEERD
FVDVTAASLDEFMESVTPGLSYNVGNELGGEDRLGVSLEFQSMNDFEPAAVARQVPALKK
LLEAREHLANLQRYMNSKPKAQDQIKQLLNDPELMAALAARESAKDASDEGTED
NT seq 525 nt   +upstreamnt  +downstreamnt
atggccgctgacaagtcgaccgattttatcaaacgcaatcgcccgcctcgggtgaacatt
tcctacgaagatccctatgacagcgaaaagatggtcgagctgccctttgtgatgggtgtg
atgtccgatctgtcgggcaatgcgtcgcctgtcgataaagaggcaatggaagagcgtgac
tttgtcgacgtcaccgccgcctcgctggatgaattcatggaaagcgtgacgccgggcctg
tcctataacgtcggcaacgaactgggtggcgaagatcgtctgggcgtcagcctggaattc
cagtcgatgaatgatttcgagccggcagccgtggcgcgccaggttccggcgctgaaaaag
ctgctggaggcgcgcgagcatctggccaatcttcagcgctacatgaactcgaaacccaag
gcgcaggaccagatcaagcaactcttgaacgaccccgagctgatggcggcactggcagcg
cgtgaaagcgccaaggacgcatccgacgaagggacggaggattaa

DBGET integrated database retrieval system