KEGG   Paracoccus sp. BM15: CUV01_07985Help
Entry
CUV01_07985       CDS       T05237                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
paro  Paracoccus sp. BM15
Pathway
paro00564  Glycerophospholipid metabolism
paro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paro00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CUV01_07985
Enzymes [BR:paro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CUV01_07985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C
Motif
Other DBs
NCBI-ProteinID: AUH33336
UniProt: A0A2K9ERD4
LinkDB All DBs
Position
1620641..1622191
Genome map
AA seq 516 aa AA seqDB search
MPETTDLFIIGGGINGCGIARDAVGRGLSVRLAEMGDLAQATSSKSTKLFHGGLRYLEYL
EIRLVREALRERETLLRAMPHISWPMRFVLPLDPEMSFESNTPVSKALSLVMPWKKGHRP
NFLIRTGLFLYDSLGGRKILPGTKSVDLTKGPEGRPLKSRLTQAYEYSDCWVDDARLVAL
NARDAAERGADILVGAEVSEAAREGKLWRIALTDGRVFHARALVNAGGPWVGHVIRDVVH
LPTTESVRLVRGSHIVVPKLYDHDKAYFFQGADGRIIFAIPYERDFTLIGTTDQDHEGSP
LDAQCTPEEQQYLCDFASRYFKQPVTRAQIVWTYSGVRPLYDDGAKSATAATREYVLSLD
DNGAPCLNVFGGKITTYRKLAEHALEKLAPNFPDRGGDWTAGVPLPGGNFPVTAVAQLIA
ALRRDYPFLTKDWAHRLIRAYGLDARAILGDAREAGDLGRDFGATLTEAELRWLMDHEFA
RHAEDIVWRRSKLGLRMQPEQIAALDVWLSEKRAAA
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgccggaaacaaccgatctgttcatcattggcggcgggataaacggctgcggaatcgcg
cgcgatgccgtgggtcgcgggctatcggtgcggctggccgagatgggcgatctggcacag
gcgaccagttccaaatcaaccaagctgttccacggtgggctgcgctatctggaatatctg
gagatccggctggtacgcgaggccctgcgcgagcgtgaaaccctgctgcgcgccatgccc
catatcagttggccgatgcgctttgtactgccgctggacccggagatgagctttgaatcc
aacacgcctgtcagcaaggcgttgtcgctggtcatgccgtggaaaaagggccatcgcccg
aatttcctgatccgcaccggtctgttcctgtacgacagccttggtgggcgcaagatcctg
ccggggaccaagtccgtcgatctgaccaagggccctgaggggcggccactgaaatcacgg
ctgacccaagcctatgaatacagcgattgctgggtggatgatgcgcggctggtggcgctg
aatgcgcgcgacgcagccgaacgcggcgcagatatcctggttggtgcagaggtgtccgag
gccgcccgcgagggcaagctgtggcgcatcgcgctgaccgatggccgtgtctttcacgcg
cgcgcgctggtaaatgcgggcggtccctgggttggtcacgtgatccgcgatgtggtccat
ttgcccacaaccgaatccgttcggctggtccggggcagccatatcgtggtgcccaagcta
tacgaccacgacaaagcctatttctttcagggcgccgatggtcggatcatctttgcgatc
ccgtatgagcgcgatttcacgctgatcggcaccaccgatcaagatcacgagggcagcccg
ctggatgcgcaatgcacgcccgaggaacagcagtatctgtgcgattttgccagccgttat
ttcaaacaaccggtcacgcgcgcgcagatcgtctggacctattccggcgtgcgcccgctg
tatgatgatggcgcgaagtcagccacggcggcgacgcgcgaatatgtgctgtcgctggac
gataacggcgcgccctgcctgaatgtctttggcggcaagatcaccacctatcgcaagctg
gccgaacatgcgctggaaaagctggcaccgaatttcccggatcgcggcggcgactggacg
gctggcgtgcccctgcccggcgggaatttcccggtgactgcggtcgctcagttgatcgcg
gcacttcgccgcgactacccgttcctgaccaaagattgggcgcaccgcttgatccgtgcc
tacgggctggatgcgcgcgccatccttggtgatgcgcgcgaggcgggtgatctgggccgc
gatttcggggccaccctgaccgaggcggaactgcgctggctgatggatcacgaattcgcc
cgccacgcagaggacatcgtctggcggcgcagcaagctgggattgaggatgcagcccgaa
cagatcgccgcactggacgtgtggctaagtgaaaagagagccgccgcatga

DBGET integrated database retrieval system