KEGG   Paracoccus sp. BM15: CUV01_12475Help
Entry
CUV01_12475       CDS       T05237                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
paro  Paracoccus sp. BM15
Pathway
paro00240  Pyrimidine metabolism
paro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CUV01_12475
Enzymes [BR:paro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CUV01_12475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30
Motif
Other DBs
NCBI-ProteinID: AUH34100
UniProt: A0A2K9EGK4
LinkDB All DBs
Position
complement(2553737..2554309)
Genome map
AA seq 190 aa AA seqDB search
MAKLYFHYSTMNAGKSTLLLQASYNYRERGMATLLLTAALDDRAGTGRIASRIGISDDAL
TFDSATDLFALIGSQGTDLACIFIDEAQFLTRDQAWQLARVADDLGIPVMCYGLRVDFRG
ELFPGSAALLALADDLREVRTICHCGRKATMVIRRGEDGRAITEGAQVQVGGNETYVSLC
RRHWREAVGR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctttatttccactattcgaccatgaatgccggcaaaagcaccttgctgttg
caggcctcttacaactaccgcgaacgcgggatggcgacgctgctcttgaccgccgcgctg
gatgatcgcgccggcaccgggcgcatcgccagccggatcggcatctctgacgacgcgctg
acctttgacagcgccaccgatctctttgcgctgatcggcagccagggcacggatctggcc
tgcatcttcatcgatgaggcgcagttcctgaccagggatcaggcctggcaactggcccgc
gtggccgatgatctgggcataccggtcatgtgttacgggctgcgggtcgatttccggggc
gagttgttcccgggcagcgccgcgttgctggcgctggccgatgatctgcgcgaggtccgc
accatctgccattgcgggcgcaaggcgaccatggtgatccgtcgtggcgaggatggccgc
gccatcaccgagggtgcccaggtgcaggttggcggcaacgaaacctatgtctcgctttgc
aggcgtcactggcgcgaggcagtgggccgctaa

DBGET integrated database retrieval system