KEGG   Paracoccus sp. BM15: CUV01_13615Help
Entry
CUV01_13615       CDS       T05237                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
paro  Paracoccus sp. BM15
Pathway
paro00061  Fatty acid biosynthesis
paro00780  Biotin metabolism
paro01100  Metabolic pathways
paro01130  Biosynthesis of antibiotics
paro01212  Fatty acid metabolism
Module
paro_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:paro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CUV01_13615
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CUV01_13615
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CUV01_13615
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:paro01004]
    CUV01_13615
Enzymes [BR:paro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CUV01_13615
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CUV01_13615
Lipid biosynthesis proteins [BR:paro01004]
 Fatty acid synthase
  Component type
   CUV01_13615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AUH34285
UniProt: A0A2K9ERG3
LinkDB All DBs
Position
complement(2791971..2792798)
Genome map
AA seq 275 aa AA seqDB search
MSSEQKSGLMAGKRGLIMGLANDKSIAWGIAQAVAAQGAELAFSYQGEALKKRVGPLAEQ
VGSSLILPCDVGDGASIDDLFAKLKDEWGQLDFVVHAIGFSDKEQLRGRYVDTTRDNFAM
TMDISVFSFTAICQRAAAMMPDGGSLLTLTYYGAERVMPHYNVMGVAKAALEASVRYLAE
DLGKDGIRVNAISAGPIKTLAASGIGDFRYIMKWNELNSPLRRNVTQADVGKSALYLLSD
LGSGVTGETHHVDAGYHVVGMKAVDAPDIATVTKG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcgagcagaaatccgggctcatggctggcaagcgcgggcttatcatggggctg
gcgaatgacaagtcgatcgcatggggcatcgcgcaggcggtcgccgcccaaggtgcggaa
ctggcgttttcctatcagggcgaggcgctgaaaaagcgcgtcggaccgctggccgagcag
gtcggatcgtcgctgatcctgccttgcgatgtcggtgatggcgcctcgattgacgacctg
tttgccaagctcaaggacgagtggggccaactggatttcgtcgtccacgccatcggcttt
tccgacaaggaacagctgcgcggccgatacgtcgataccacccgcgacaacttcgccatg
acgatggacatctcggtcttttccttcaccgccatctgccagcgcgccgccgcgatgatg
cccgacggtggcagtctgctgaccctgacctattacggggccgaacgcgtgatgccgcat
tacaacgtgatgggcgtggccaaagcggccctcgaggcatctgtgcgctatctggccgag
gatcttggcaaggacggcatccgcgtgaacgcgatcagtgccggtccgatcaagaccctg
gccgccagcgggatcggcgatttccgctatatcatgaagtggaacgagctgaactcgccg
ttgcgccgcaacgtgacgcaggccgacgtgggcaaatcggcgctgtatctgctgtcggat
ctggggtccggcgtaacgggcgagacgcatcatgtcgatgccggctatcatgtcgtcggc
atgaaggccgtggacgcccccgatatcgcgacggtcaccaaaggctga

DBGET integrated database retrieval system