KEGG   Paracoccus sp. BM15: CUV01_17105Help
Entry
CUV01_17105       CDS       T05237                                 

Definition
(GenBank) acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase
  KO
K00677  UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Organism
paro  Paracoccus sp. BM15
Pathway
paro00540  Lipopolysaccharide biosynthesis
paro01100  Metabolic pathways
paro01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:paro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CUV01_17105
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    CUV01_17105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:paro01005]
    CUV01_17105
Enzymes [BR:paro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.129  acyl-[acyl-carrier-protein]---UDP-N-acetylglucosamine O-acyltransferase
     CUV01_17105
Lipopolysaccharide biosynthesis proteins [BR:paro01005]
 Lipid A
  CUV01_17105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Acetyltransf_11 Hexapep_2
Motif
Other DBs
NCBI-ProteinID: AUH34870
UniProt: A0A2K9EIR3
LinkDB All DBs
Position
complement(3480540..3481328)
Genome map
AA seq 262 aa AA seqDB search
MADAGIHPSAVIEPGAEIGPDCRIGPFCVVGSQVRLARGVVLKSHVVLTGETSVGEETVI
FPFACIGEIPQDLKFKGERAALEIGARNRIREYVTMNPGTEGGGGVTRVGDDGLFMAGSH
VAHDCQIGNRVILVNNASVAGHCVLDDDVIIGGLSGVHQWVRIGRGAMIGAVTMVTADVI
PYGLVQGPRGHLDGLNLVGLKRRGASRADIAALRGMLGELAHGSFRDGAKARIGGEVTPM
EREVLEFILGPSDRSFLTPRPA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgccggtatccatccctctgccgtgatcgaaccgggcgcagagatcggcccc
gactgccgtatcggcccgttctgcgtggtcggatcgcaggtgcggttggcgcgcggtgtg
gtgctgaaatcgcatgtcgtgctgacgggcgagacctctgtaggtgaggaaacggtgatt
ttccccttcgcctgtatcggcgagatcccgcaggatctgaagttcaagggcgaacgcgcg
gcgctggaaatcggggcgcgcaaccggatccgcgaatatgtgacgatgaatcccggcacc
gaaggcgggggcggcgtgacacgcgtcggcgatgacgggctgttcatggccggcagccat
gtcgcccatgactgccagattggcaaccgggtaatcctggtcaacaatgcctcggtcgcg
ggccattgcgtgctggacgatgacgtgatcatcggcggcctgtcaggcgtgcaccaatgg
gtgcgcattggccgtggcgcgatgatcggcgcggtcacaatggtgacggccgatgtcatt
ccctacgggctggtacaggggccgcgcggccatctggacgggctcaatctggttgggctc
aagcgtcgcggggccagccgggccgatatcgcagcgctgcgcgggatgctgggcgaattg
gcgcacggctcgttccgcgacggtgccaaggcgcggataggtggcgaggtgacgccgatg
gagcgcgaggtgctggaattcatccttggtccttcggatcgcagcttcctgacgccgcgc
cccgcatga

DBGET integrated database retrieval system