KEGG   Paracoccus sp. Arc7-R13: EOJ32_11395Help
Entry
EOJ32_11395       CDS       T06050                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
parr  Paracoccus sp. Arc7-R13
Pathway
parr00970  Aminoacyl-tRNA biosynthesis
parr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:parr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EOJ32_11395 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:parr03029]
    EOJ32_11395 (gatB)
Enzymes [BR:parr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     EOJ32_11395 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     EOJ32_11395 (gatB)
Mitochondrial biogenesis [BR:parr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    EOJ32_11395 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AZY94212
UniProt: A0A3T0Q369
LinkDB All DBs
Position
2285540..2287051
Genome map
AA seq 503 aa AA seqDB search
MLDLTFTAPQPKVIQGAQGDWELVIGLEVHAQVASNAKLFSGASTRFGSEPNSNVAFVDA
AMPGMLPVINEFCVAQAVRTGLGLKAQINLRSAFDRKNYFYPDLPQGYQISQLYHPIVGE
GEIIVDMAPGVARRVRVERIHLEQDAGKSIHDMDPTMSFVDLNRTGVALMEIVSRPDIRG
PEEAAAYVVKLRQILRYLGTCDGNMQNGNLRADVNVSVCKPGDYERFQETGDFGHLGTRC
EIKNMNSMRFIQAAIDYEARRQIAILEDGGKIVQETRLYDPDKGETRSMRSKEEAHDYRY
FPDPDLLPLEIEQAWVDDIAASMPELPDEKKARFVQGMGLSEYDAGVLTAEVENADYFEA
VASGRDGKMAANWVINELFGRLNKEGLTIATSPVSAAQLGGVIDLIASDAISGKIAKDLF
EILWTEGGDPARIVEERGMKQVTDLGAIEAAVDQIIADNPAQVEKARANPKLAGWFVGQV
LKATGGKANPAAVNDMVARKLAL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacctgaccttcaccgccccgcagccgaaagtgatccaaggcgcgcaaggcgat
tgggagctggtgatcgggctggaggttcacgcccaggtcgcatcgaacgccaagctgttt
tccggcgcgtcgacccgtttcgggtccgagcccaacagcaacgtggccttcgtcgatgcg
gccatgccgggcatgctgccggtcatcaacgaattctgcgtggcgcaggcggtccgcacc
ggcctgggcctgaaggcccagatcaacctgcgcagcgcgttcgaccgcaagaattatttc
tatcccgacctgccgcagggctatcagatcagtcagctgtaccaccccatcgtgggcgag
ggagagatcatcgtcgacatggcccccggcgtcgcccgccgcgtccgcgtcgagcgcatc
cacctggaacaggacgcgggcaagtcgatccacgacatggacccgaccatgtcctttgtt
gatttgaaccgcaccggcgtcgccctgatggagatcgtcagccgccccgacatccgcggc
cccgaggaggccgccgcctatgtcgtcaagctgcgccagatcctgcgctatctgggcacc
tgcgacggcaacatgcagaacggcaacctgcgcgccgacgtcaacgtcagcgtctgcaag
cccggcgattacgaacggttccaggagaccggcgatttcggccatctgggcacgcgctgc
gagatcaagaacatgaactcgatgcgcttcatccaggcggccatcgactatgaggcccgg
cgccagatcgcgatcctggaggatggcggaaagatcgtccaagagacgcgcctttatgat
cccgacaagggagagacgcggtcgatgcggtcgaaggaggaggcgcatgattaccgctac
ttccccgaccccgacctgctgccgctggagatcgagcaggcctgggtggacgacatcgcg
gcatccatgcccgaactgcccgatgagaagaaggcccgcttcgtgcagggcatgggcctg
tcggaatacgatgcgggcgtgctgaccgcagaagtcgagaacgccgattacttcgaggcc
gtggcatcgggccgcgacgggaagatggccgcgaactgggtcatcaacgaactgttcggc
cgcttgaacaaggaaggtctgaccatcgcgacctctccggtgtccgccgcgcagttgggc
ggcgtgatcgacctgatcgcatcggacgcgatttccggaaagatcgccaaggacctgttc
gagatcctgtggaccgaaggcggcgaccccgcccggatcgtcgaggaacgcggcatgaag
caggtcaccgaccttggcgcgattgaggccgctgtggaccagatcatcgccgacaacccc
gcccaggtcgaaaaggcacgcgccaaccccaagctggcgggctggttcgtgggccaggtg
ctgaaggccaccggcggcaaggcgaaccccgccgccgtcaacgacatggtcgcccggaaa
ctggctctgtga

DBGET integrated database retrieval system