KEGG   Paracoccus sp. Arc7-R13: EOJ32_15835Help
Entry
EOJ32_15835       CDS       T06050                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
parr  Paracoccus sp. Arc7-R13
Pathway
parr00040  Pentose and glucuronate interconversions
parr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:parr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EOJ32_15835
Enzymes [BR:parr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     EOJ32_15835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AZY95003
UniProt: A0A3T0Q502
LinkDB All DBs
Position
3189360..3190400
Genome map
AA seq 346 aa AA seqDB search
MATSLVLERKGQLALRDIALDQDLSPTDVRIAVHTVGICGSDVHYYTHGKIGPFVVEQPM
VLGHEASGTVVEVGAQVTHLKPGDRVCMEPGIPDATSRAAKLGIYNVDPAVRFWATPPVH
GCLTPQVVHPAAYTYRLPDQVSFAQGAMVEPFAIGMQAALRARIQPGDIGLVTGAGPIGM
MTALAALAGGCAKVLVADLAQPKLDIIGAYPGIETVNIRTTPAAQAIAEATGGWGADVVF
ECSGAAPAILGLPALARPGGTIVLVGMPVDPVPVDIVGLQAKELRIETVFRYANVYDRAI
SLIAAGKVDLSPLISATIPFADSIAAFDRAVEARDTDVKIQIRMPD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcgacatcactggtactggaacgcaagggtcagctggcgctgcgcgacatcgcgctg
gatcaggacctgtcgcccaccgacgtgcgcatcgcggtccatacggtcggcatctgcggg
tccgacgtgcattactatacccacggcaagatcggccccttcgtggtcgagcagccgatg
gtcctggggcacgaggcatcgggcaccgtggtcgaggtcggcgcccaggtcacgcacctg
aagcccggcgacagggtctgcatggagcccggcattcccgatgcgacctcgcgcgcggcc
aagctgggcatctacaacgtcgatccggcggtgcggttctgggccaccccgcccgtgcat
ggctgcctgacgccgcaggtcgtgcatccggcggcctatacctaccggctgcccgatcag
gtctccttcgcgcagggcgcgatggtcgagccctttgcgatcggcatgcaggccgcgttg
cgggcgcgcatccagccgggcgacatcggccttgtcaccggcgccgggcccatcggcatg
atgaccgcgctggcggcgctggcggggggctgcgccaaggtgctggtcgcggacctggcc
cagcccaagctggacatcatcggcgcctatccgggcatcgagaccgtcaacatccgcacc
acccccgcagcccaggcgatcgccgaggccaccggcggatggggtgcggacgtcgtcttc
gaatgttccggggcggcccccgcgatcctgggcctgccggcgctggcgcgtccgggcggc
acgatcgtgctggtcggcatgccggtcgatccggtgccggtcgacatcgtcggcctgcag
gccaaggagctgcgcatcgagacggtgttccgctatgccaacgtctatgaccgcgcgata
tcgctgatcgcggcgggcaaggtcgacttgtcgccgctgatctcggctactatcccgttc
gcggacagcatcgccgccttcgaccgtgcggtcgaggcgcgcgacaccgacgtcaagatc
cagatccgcatgccggactga

DBGET integrated database retrieval system