KEGG   Paracoccus sp. SC2-6: DRW48_00170Help
Entry
DRW48_00170       CDS       T05723                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pars  Paracoccus sp. SC2-6
Pathway
pars00010  Glycolysis / Gluconeogenesis
pars00020  Citrate cycle (TCA cycle)
pars00620  Pyruvate metabolism
pars01100  Metabolic pathways
pars01110  Biosynthesis of secondary metabolites
pars01120  Microbial metabolism in diverse environments
pars01130  Biosynthesis of antibiotics
pars01200  Carbon metabolism
Module
pars_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pars00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DRW48_00170
   00020 Citrate cycle (TCA cycle)
    DRW48_00170
   00620 Pyruvate metabolism
    DRW48_00170
Enzymes [BR:pars01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DRW48_00170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AXC48335
UniProt: A0A344PG30
LinkDB All DBs
Position
37120..38451
Genome map
AA seq 443 aa AA seqDB search
MATEILMPALSPTMEEGTLAKWLVKEGDAVKSGDILAEIETDKATMEFEAVDEGVIGKLL
VPEGSAGVKVNAPIATLLEEGEDASAAPAPKAEAPKSEAPQTAPKAEVSTQPAGTPTEAP
AKAAAPATKVGGDRVFASPLARRLAAEKGIDLAGVAGSGPHGRIVKSDIDAAKPGQITAA
APKAEAATPAAAPSAAPAMPQGMSADMVKKLFADRETEEVLLDGMRKTIAQRLTEAKQTI
PHFYLRRSARIDALLAFRAQLNKSLEGRGTKLSVNDFIIKACALALQEVPDANAVWAGDR
ILKIKPSDVGVAVAVEGGLFVPVLRDANTKSLSTLSHEMRDLGARAKRKKLAPTEYLGGR
FAISNLGMFGIENFDAVINPPHGSILAVGAGLRQPVVEGDEIKIATVMSMTLSVDHRVID
GALGAQLLERIVTHLENPMAMLA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgaaatcctgatgcccgcgctatcccccacgatggaggaaggcaccctggcc
aagtggctggtcaaagagggcgatgcggtcaaatccggcgacatcctcgccgagatcgag
accgacaaggcgacgatggagttcgaggcggtcgatgaaggcgtgatcggcaaactgctg
gttcccgaggggagcgcaggggtcaaggtgaacgcccccattgcgaccctgctggaagag
ggcgaggacgcaagtgccgcccctgcccccaaggccgaagcgccgaaatccgaggcgcca
cagactgccccgaaagctgaggtaagcacacaacctgcgggcacgccgaccgaggcgccc
gcgaaggccgccgcacccgcgacgaaagtcggcggggaccgggtctttgcctcgcccctc
gcccgccggctggctgccgagaagggaattgatctcgcgggcgtcgcgggctccggcccg
catggacggatcgtcaaatccgacatcgacgcagcgaagcccggacagatcaccgctgcg
gcacccaaggccgaggccgcgacaccggccgctgccccctccgccgcgcccgccatgccg
cagggcatgtcggccgatatggtcaagaagctgttcgccgaccgcgagaccgaggaagtg
ctgctggacgggatgcgcaagaccatcgcccagcgcctgaccgaggccaagcagaccatc
ccgcatttctacctgcgccgcagcgcccgcatcgacgccctgctggcgttccgcgcgcag
ctgaacaagtcgctggagggccggggcacgaaactgtcggtcaacgacttcatcatcaag
gcctgcgcgctggcgctgcaggaagtgccggatgccaacgccgtctgggccggcgaccgc
atcctgaagatcaagccgtccgacgtgggcgtcgccgtcgcggtcgagggcgggctgttc
gtgccggtcctgcgcgatgccaacaccaagagcctgtcgacgctgagccacgagatgcgc
gatctcggcgcgcgggccaagcgcaagaagctggcgccgaccgaatatctcggcggccgc
tttgcgatcagcaacctcggcatgttcggcatcgagaatttcgacgccgtcatcaacccg
ccgcacggctcgatcctcgcggtcggcgccggcctgcggcagccggtggtcgagggcgac
gagatcaagatcgccacggtcatgtcgatgaccctgtcggtggatcaccgcgtgatcgac
ggcgccctcggggcgcaactgctggagcggatcgtgacgcatctggaaaacccgatggcg
atgctggcctaa

DBGET integrated database retrieval system