KEGG   Paracoccus sp. SC2-6: DRW48_03130Help
Entry
DRW48_03130       CDS       T05723                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pars  Paracoccus sp. SC2-6
Pathway
pars03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pars00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    DRW48_03130 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pars03400]
    DRW48_03130 (ligD)
Enzymes [BR:pars01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DRW48_03130 (ligD)
DNA repair and recombination proteins [BR:pars03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     DRW48_03130 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AXC48817
UniProt: A0A344PHG2
LinkDB All DBs
Position
complement(640889..643315)
Genome map
AA seq 808 aa AA seqDB search
MESLATYRSKRNFGDTPEPAGVARPRGLGLHYSMQCHDATRLHYDLRLEWGGVLLSWAVT
RGPSLDPADKRLAVRTEDHPLDYLRFEGTIPAGNYGAGVVMLWDIGTWQPVDDIDRGLAK
GHLRLRIIGRRLTGEWHLVRIKGKPSDKGRENWLLIKQEDAAAHQPDPVARYTSSVLTNR
DHAQIAADAEPRPFGPPRKAPAPAFEAPMLPTLVKDAPGADGWWHELKFDGYRGQIQIGA
EGARFRTRSGLDWSDRFESLLPAFEELPAKTALIDGEVVAGADLGGFGALQRAIGEGGPF
RFYAFDLLERDGCDLRDEPLSKRRKALEALLKDAPPMGLIELSTVIDGDGAEVLAPICEA
GGEGIVSKRSDSPWRSGRTTAWLKTKCERRAEFVVLGWQPSDKRGREFSSLLLGTHEGGK
WIYRGKVGTGFDMATQADLAARLERLKAPMVLDKRPADARGAVWVKPQLTVEIRYGEVTD
DGQLRHAAYVGLREDKPAEEVVMDSEAPTTVSDGERVIVATIGVSHPERVLFPPKGPTKL
ELAQYYADIADRMLPMTANRPLSLVRLPDGLGGQAFFQKHLRKGWPKSLKPVPVETSSGV
EDYMYVTDAAGLVGAVQMGTVEFHIWGSRRDNLDRPDRMVFDLDPDEGLDWEKVRTAAFE
MRDVLAELGLPSWPMLTGGKGVHVVIPLRRTVGWDTVKLFSHTVASHCAERWPDRYLANM
SKAKRSGRIFIDYLRNERGSTAIAPFSVRARPGATVAFPLSWQALEDAPGANAYDMKRAL
AEGNWDNVGVPAPASLPAAIKKMAQLWG
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgctcgccacctatcgatccaaacgcaatttcggcgacacgcccgaacctgcg
ggcgtcgcaaggccgcgggggctggggctgcattattccatgcagtgccacgacgcgacg
cggctgcattacgatttgcggctggaatgggggggcgtgctgctcagctgggcagtgacg
cgcgggccgtcgctggacccggccgacaagcggctggccgtgcggaccgaggatcatccg
ctggattatctgcgcttcgagggcaccattccggccggcaattacggcgccggggtcgtc
atgctgtgggacatcggcacgtggcagccggtcgacgacatcgaccgcggccttgccaag
ggccacttgcggctgcggatcatcggccggcgcctgacgggcgagtggcacttggtgcgc
atcaagggcaagccctccgacaagggccgtgagaactggttgctgatcaagcaggaggac
gcggccgcgcatcagcccgatccggtcgcgcggtacaccagctcggtgctgacaaatcgc
gatcacgcccagatcgccgctgatgccgagccgcggccctttggcccgccccgcaaggcg
cccgcgccggcattcgaggcgccgatgctgccaacgctggtcaaggatgccccgggcgcg
gatggctggtggcacgaactgaagttcgacggctatcgcggccagatccagatcggcgcg
gagggggcgcggttccgcacccggtccggcctcgactggtcggaccgttttgaatcgctg
ctgcccgcctttgaggaactgcccgccaagaccgcgctgattgatggcgaggtcgtggcc
ggcgccgacctgggcggttttggtgcgctgcaacgtgccatcggcgagggcggcccgttc
cggttctatgccttcgacctgcttgagcgcgatggctgtgacctgcgggacgagccgctg
agcaagcggcgcaaggcgcttgaggcgctgctgaaggacgcgccccccatggggctgatc
gagctgtcgaccgtgatcgatggcgacggcgcggaagtgctggcgccgatctgcgaggcc
ggcggcgaggggatcgtcagcaagcgcagcgactcgccttggcgcagcgggcgcacgacc
gcctggctgaagaccaaatgcgagcgccgggccgagtttgtggtcctgggctggcagccg
tctgacaagcgcgggcgcgagttctcgtccctgctgctgggcacgcatgagggcggcaaa
tggatctatcgcggcaaggtgggcaccgggttcgacatggccacgcaggccgatctggcc
gcccggctggagcgcctgaaagcgccgatggtgctggacaagcgcccggcggatgcgcgc
ggtgcggtctgggtcaagccacagttgacggtcgagattcgctatggcgaggtgaccgat
gatggccaattgcgccacgccgcctatgtcgggctgcgcgaggacaagcccgccgaggag
gtcgtgatggatagcgaggcccccacaaccgtcagcgacggcgagcgcgtcatcgtcgcc
accatcggcgtctcgcaccccgaacgggtgctgttcccgcccaaaggcccgaccaagctg
gagttggcccagtattacgccgatattgccgaccgtatgctgccgatgacggcgaaccgg
ccattgtcgctcgtgcgcctgccggacgggttgggcgggcaggccttctttcaaaagcac
ctgcgcaagggttggccaaagtcgctgaagccggtcccggtcgagacctcgtccggcgtc
gaggactacatgtacgtcaccgacgctgcgggcctggtcggcgcggtgcagatggggacg
gtcgagtttcacatctggggcagccgccgcgacaatctggaccgccccgaccgcatggta
ttcgacctcgacccggatgagggcctcgattgggaaaaggtgcgcactgccgcgttcgag
atgcgggacgtactggcagaactgggcctgccgagttggcccatgctgaccggcggcaag
ggcgtgcatgtggtgatcccgctgcgccgcacggtcgggtgggacacggtcaagctgttc
tcgcatacggtggcctcgcactgcgccgagcgctggccggaccgttatctggccaacatg
tccaaggccaagcgcagcgggcgcatctttatcgactacctgcgcaacgagcgcggctcg
accgccatcgcgcccttttcggtccgggcgcggccgggggcaacggtcgcgttcccgctg
tcgtggcaggcgctcgaggatgcgccgggtgccaatgcctatgacatgaaacgcgccctg
gccgagggcaactgggacaatgtcggcgtgccggccccggcaagcctgcccgccgcgatc
aagaaaatggcccagctttggggctga

DBGET integrated database retrieval system