KEGG   Paracoccus sp. SC2-6: DRW48_09400Help
Entry
DRW48_09400       CDS       T05723                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pars  Paracoccus sp. SC2-6
Pathway
pars00020  Citrate cycle (TCA cycle)
pars00190  Oxidative phosphorylation
pars00650  Butanoate metabolism
pars01100  Metabolic pathways
pars01110  Biosynthesis of secondary metabolites
pars01120  Microbial metabolism in diverse environments
pars01130  Biosynthesis of antibiotics
pars01200  Carbon metabolism
Module
pars_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pars_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pars_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pars00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DRW48_09400
   00650 Butanoate metabolism
    DRW48_09400
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DRW48_09400
Enzymes [BR:pars01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DRW48_09400
    1.3.5.4  fumarate reductase (quinol)
     DRW48_09400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 DAO Thi4 FAD_binding_3 FAD_oxidored HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AXC49876
UniProt: A0A344PKH1
LinkDB All DBs
Position
1929720..1931525
Genome map
AA seq 601 aa AA seqDB search
MSAAYPFETHEYDVVVVGAGGAGLRAALGMAEQGLRTACVTKVFPTRSHTVAAQGGIAAS
LSNMGPDNWQWHMYDTVKGSDWLGDTDAMEYLAREAPQAVYELEHYGVPFSRTADGRIYQ
RPFGGHTTEFGEGPPVQRTCAAADRTGHAILHTLYGQALKQKAQFFIEYFALDLIITDGA
CTGVVCWKLDDGTLHVFNAKMVVLATGGYGRAYFSATSAHTCTGDGGGMAARAGLPLQDM
EFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLASRDVVSRCMTLE
IREGRGVGDHKDHIFLHLSHLPPETLHERLPGISESAKIFAGVDLTREPIPVLPTVHYNM
GGIPTNFWGEVLDPTQDNPDRVFPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI
QAGKVIDRKTPVPPTNTAEVDKILGRFDALRHASGAIPTAQLRGEMQRTMQADAAVFRTD
KTLAEGVDKMEAIAAKMSDLHVTDRSLIWNTDLMETLELTNLMPNALTTIVAAEARKESR
GAHAHEDWPERDDVNWRKHSLARVDGTGVTLSYRPVHLEPLTTVEEGGIDLKKIAPKARV
Y
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgcagcatatccctttgagacgcacgaatatgacgtcgtcgtggtcggcgccggc
ggggccggcctgcgggccgccctcggcatggccgagcagggcctgcgcaccgcttgcgtg
accaaggtctttccgacccgcagccataccgtcgcggcacagggtggcatcgccgccagc
ctgtccaacatgggccccgacaactggcagtggcacatgtatgacaccgtcaagggcagc
gactggctgggcgacaccgacgccatggaatacctcgcccgcgaggcgccgcaggcggtc
tatgagttggaacattacggcgtgcccttcagccgcacggccgatggccgcatttaccag
cggcccttcggcggccacaccaccgagttcggcgagggcccgcccgtccagcgcacttgt
gccgccgccgaccggaccggccacgccatcctgcacacgctctacggccaggcgctgaag
cagaaggcgcagttcttcatcgaatatttcgcgctcgacctgatcataaccgacggcgcc
tgcaccggcgtcgtgtgctggaagctcgacgacggcacgctgcatgtgttcaacgccaag
atggtcgtgctggccaccggcggctacggccgggcctatttcagcgccacaagcgcgcat
acctgcaccggggacggaggcgggatggcggcacgcgccggtctgccgctgcaggacatg
gagttcgtgcagttccacccgaccgggatctatggctcgggctgcctcatcaccgagggg
gcacggggcgagggcggctacctgaccaactcggaaggcgagcggttcatggaacgctac
gcgccgacctacaaagacctcgccagccgggacgtcgtcagccgctgcatgacgctggag
atccgcgagggtcgcggcgtcggcgatcacaaggaccacatcttcctgcacctgtcgcac
ctgccgcccgagacgctacacgagcgcctgcccggcatcagcgaaagcgccaagatcttt
gccggggtcgatctgacccgcgagccgatcccggtcctgccgacagtgcattacaacatg
ggcggaattcccacgaacttctggggcgaagtccttgatccgacgcaggataaccctgac
cgcgtgttccccggcctgatggcggtgggcgaggcgggctgcgcgtcggtccacggcgct
aaccgcctcggctcgaacagcctgatcgacctggtggtctttggccgggctgctgcgatc
caggcgggcaaggtgatcgaccgcaagacccccgtgccgccgaccaacaccgccgaggtg
gacaagatcctcggtcggttcgacgcgctgcgtcatgcaagcggcgccatccccaccgcc
cagctgcgcggcgagatgcagcgtaccatgcaggccgatgcggcggttttccgcaccgac
aagaccctggccgaaggggtggacaagatggaggcgatcgccgccaagatgtccgacctg
catgtcaccgaccggtcgctgatctggaacaccgacctgatggagacactggagctgacg
aatctgatgccgaacgccctgacgaccatcgtcgcggccgaggcgcgcaaggaaagccgt
ggcgcccatgcgcacgaggactggcccgaacgcgatgatgtcaactggcgcaagcattct
ctggcgcgggtcgatggaaccggcgtaacgttgagctatcgccccgtgcatctggaaccg
ctcaccacggtcgaggaaggcgggatcgacctgaagaagattgctcccaaagcgagggta
tattaa

DBGET integrated database retrieval system