KEGG   Paracoccus sp. SC2-6: DRW48_09415Help
Entry
DRW48_09415       CDS       T05723                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pars  Paracoccus sp. SC2-6
Pathway
pars00020  Citrate cycle (TCA cycle)
pars00190  Oxidative phosphorylation
pars00650  Butanoate metabolism
pars01100  Metabolic pathways
pars01110  Biosynthesis of secondary metabolites
pars01120  Microbial metabolism in diverse environments
pars01130  Biosynthesis of antibiotics
pars01200  Carbon metabolism
Module
pars_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pars_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pars_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pars00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DRW48_09415
   00650 Butanoate metabolism
    DRW48_09415
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    DRW48_09415
Enzymes [BR:pars01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     DRW48_09415
    1.3.5.4  fumarate reductase (quinol)
     DRW48_09415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AXC49879
UniProt: A0A344PKH4
LinkDB All DBs
Position
1932381..1933160
Genome map
AA seq 259 aa AA seqDB search
MVQFRLPKNSQIKVGKTWPAPEGATRLRKFKIYRFEPDSGENPRLDTYFIDLDKCGPMVL
DALIKIKTEIDPTLTFRRSCREGICGSCAMVIDGGNHLACIYGIDEVPGDVAIYPLPHMP
VIKDLVADLTMFYAQHAYVQPWLETETPPPHKEWLQSVEDRKKLDGLYECILCACCSTSC
PSYWWNGDRFLGPAALLTAYRWISDSRDEATGERLDDLEDPFKLYRCHTIMNCTNTCPKG
LNPAKAIASIKHMMVERSH
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtccagttccgcctgcccaagaacagccagatcaaggttggaaagacctggcccgcc
cccgagggcgcgacccggctgcgcaagttcaagatctatcgcttcgaacctgacagcggg
gaaaacccgcgtctggacacctatttcatcgatctcgacaaatgcggtccgatggtcctt
gacgcgctgatcaagatcaagaccgagatcgacccgacgctgacctttcgccgctcgtgc
cgcgaggggatttgcgggtcctgcgcgatggtgatcgacggcggcaaccacctcgcctgc
atctacggcatcgacgaggtgccgggcgatgtcgcgatctatccgctaccgcacatgccg
gtcatcaaggacctggtcgcggacctgaccatgttctacgcccagcacgcctatgtgcag
ccttggctggagaccgagacgccgcccccgcacaaggaatggctgcagtcggtcgaggac
cgcaagaagctggacgggctttacgagtgcattctgtgcgcctgctgctcgacctcttgc
cccagctactggtggaacggtgatcgcttcctcgggccggcggccctgttgacggcgtat
cgctggatctcggattcgcgcgacgaggcgaccggcgagcggctggacgatctggaggat
ccgttcaagctgtatcgttgccacacgattatgaactgcaccaacacctgtcccaagggg
ctgaacccggccaaggccatcgcctcgatcaagcacatgatggtcgaacgcagccactga

DBGET integrated database retrieval system