KEGG   Paracoccus sp. SC2-6: DRW48_10150Help
Entry
DRW48_10150       CDS       T05723                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
pars  Paracoccus sp. SC2-6
Brite
KEGG Orthology (KO) [BR:pars00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DRW48_10150
Enzymes [BR:pars01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DRW48_10150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 SPOR Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AXC50006
UniProt: A0A344PKV1
LinkDB All DBs
Position
complement(2100925..2102493)
Genome map
AA seq 522 aa AA seqDB search
MIAVALTAATTAQQAGAAPFAAYVMDGRTGKTLHSQNGDTPLHPASLTKMMTLYLAFAAI
EQGRVRLDSRFTVSQHAASMPPSKLGLRPGQQIELRYLIRAAAVKSANDAATVIGEGLAG
SEPAFAQQMTATARALGMRNTQFRNANGLSADGHYSSAHDLTILGRHLFYDFPQYYSIFS
RRSADAGVGTVNSTNARFLDNYQGADGIKTGYTRAAGFNLTASAQRGQQRVMATVMGGTS
TAQRNQIMAQLLDAGFSRSPARVAVVKPATVVVQPQRVRRATVPQAQAVAAVPRTVTVRP
AANVASIATSVAPVRRTQSVAAAAPSPGGIDLSEALREAMATRPEPSPERPVPARTRAPA
PVAEGDDSGSAVASLRPPTKPEGSSPDSDLSPDSAAAAPPAKSSAEPALAPARPARRDSA
ASLDGGTVKLASLESGDRPAAGKAASTNWGITLGRYRSKAEAEQMLLKTALREADALGEG
LRKVGESKRGYEARFVNLSRAQAQLACDKLQARSQKCTVNAP
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgttgcacttacggccgcgaccactgcgcagcaggcaggcgcggcgcctttt
gcggcctacgtgatggacggacgaacgggcaagacgctgcactcgcaaaacggcgacacg
cctttgcatcctgcgtcgctgacaaagatgatgacgctatatctggcctttgcggcgatc
gagcaggggcgtgtgcgcctcgacagccgcttcacggtcagccagcacgccgcctcgatg
ccgccgtccaagctgggtctgcgccccggacagcagatcgagctgcgctacttgatccgc
gccgccgccgtgaagtcggccaatgacgcggccacggtgatcggcgaggggctcgccggc
tcggagcccgcgttcgcccagcagatgaccgcgactgcgcgcgctctggggatgcgcaac
acccagtttcgcaacgccaacggtctgtcggcggatgggcactactcgtcggcgcatgac
ctgacgatcctcggccggcacctgttctacgacttcccccagtattattcgatcttctcg
cgccgcagcgccgatgctggcgtgggcacggtaaacagcaccaacgcgcgctttctggac
aactaccagggcgccgacgggatcaagaccggatatacgcgtgccgccggcttcaacctg
accgcttcggctcagcgcggccagcagcgcgtcatggcgaccgtcatgggcggcacctcg
accgcgcagcgcaaccagatcatggcgcaattgctggacgccggcttcagccgcagcccg
gcgcgggtcgcggtggtcaagccggcgaccgtcgtcgtccagccgcagcgcgtgcgccgc
gcgaccgtgccgcaggcacaggccgtcgcggcggtgccgcggacggtcaccgtgcgtccc
gcggcaaacgttgcctcgatcgcgaccagcgtcgcgccggtgcgtcgcacccagagcgtc
gccgcggccgcaccctcgccgggcgggatcgacctgtccgaggcactccgcgaggcgatg
gccacccgccccgaaccgtcgcccgagcgtccggtcccggcccgcacccgcgccccggct
ccggtcgccgagggcgacgacagtggcagcgccgtggccagcctgcgccccccgaccaag
cccgagggctcgtcgcccgacagcgacctgagcccggacagcgccgcggcggcgccgccc
gccaagtcctcagcggaaccggcactcgccccggcccggccggcgcgccgcgatagcgcc
gcctcccttgacggcgggaccgtaaaactcgcctcgctcgagtcgggcgatcgcccggcg
gcgggcaaggcggcgtcgaccaactggggcatcacccttggccgctaccgctccaaagct
gaggctgagcagatgctgctgaaaaccgcattgcgcgaggcggacgcgctgggcgaaggc
ctgcgcaaagtcggcgagagcaagcgcggctacgaggcgcgtttcgtcaacctcagccgc
gctcaagcccagcttgcctgtgacaaactgcaggcccgttcgcagaaatgcacggtcaac
gccccctga

DBGET integrated database retrieval system