KEGG   Paracoccus sp. SC2-6: DRW48_13315Help
Entry
DRW48_13315       CDS       T05723                                 

Definition
(GenBank) hypothetical protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
pars  Paracoccus sp. SC2-6
Pathway
pars00040  Pentose and glucuronate interconversions
pars00051  Fructose and mannose metabolism
pars01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pars00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DRW48_13315
   00051 Fructose and mannose metabolism
    DRW48_13315
Enzymes [BR:pars01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     DRW48_13315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AXC50528
UniProt: A0A344PMC3
LinkDB All DBs
Position
complement(2728346..2729329)
Genome map
AA seq 327 aa AA seqDB search
MALSRFATRLNSFASAPALYWSDLVGKPTTLQTIERAATVEGLTDVDLNYPDHVTGDPAL
IGRQVRDVGLNVNGLAMRYYTNPAFKLGAFTHPDRAVRREAIDLTKRGIDAAREIGSSLM
TIWLGQDGFDYNFQLDYRQAWDAEVEALREVAAHDPDCLVSVEYKPDEPRAHALLRDAAT
TLLAIQDAGSENLGVTLDFAHALYAGEQPALAAAQISRRSRLLGVHLNDGFGKRDDGLMV
GAVHVRATLELLWQIRRDGYDGALYFDTFPDASGLDPVAECAVNIRTVNRLMSVADRLDA
DNRLAEALASQDAVGSQQIVNDALMGR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
ttggccctgtcccgctttgcaacccgcttgaactcattcgcctcggcgccggcgctctat
tggtccgacctcgttggcaagccgacaacgcttcagaccatcgagcgggcggcgacggtc
gaggggctaacggatgtggacctgaactatcccgaccatgtcaccggcgacccggcgctg
atcggccggcaagtccgggacgttggcctgaacgtcaacggcctcgccatgcgatactac
accaatcccgcattcaaactcggcgccttcacccaccctgaccgggccgtgcggcgtgag
gcgatcgacctgaccaagcgcgggattgacgccgcgcgggagatcggttcctcgttgatg
accatctggctgggtcaggacggcttcgactataacttccagctcgattatcggcaggcc
tgggacgctgaggtcgaggccctgcgcgaggtggcggcgcacgacccggattgcctcgtc
agtgttgagtacaaacccgacgagccgcgggcccatgccctgctgcgcgatgccgcaacg
acgctgctggcgatccaggacgcagggtctgagaacctcggggttaccctcgatttcgcg
catgccctctatgcgggggaacagccggcccttgcagcggcccagatcagtaggcgaagc
cggctgctcggcgttcatctgaacgacggcttcggcaagcgtgacgacgggttgatggtc
ggtgcggtgcatgtgcgcgcgacgctcgagttgctgtggcagatccgtcgtgatggttat
gacggcgcactctatttcgacacattccccgatgcgagcgggcttgatcccgtcgccgaa
tgcgcggtcaacatccggaccgtcaatcgcctgatgtcggtggccgaccgtctcgacgcc
gacaaccggctggccgaggcactcgcatcccaggacgctgtagggtcccagcagatcgtc
aacgacgccctcatggggcgctaa

DBGET integrated database retrieval system