KEGG   Pseudoalteromonas arctica: PARC_a0425Help
Entry
PARC_a0425        CDS       T05179                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
part  Pseudoalteromonas arctica
Pathway
part00400  Phenylalanine, tyrosine and tryptophan biosynthesis
part01100  Metabolic pathways
part01110  Biosynthesis of secondary metabolites
part01130  Biosynthesis of antibiotics
part01230  Biosynthesis of amino acids
Module
part_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:part00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PARC_a0425 (aroK)
Enzymes [BR:part01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     PARC_a0425 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_33 Cytidylate_kin Thymidylate_kin dNK AAA_18 HHH_6
Motif
Other DBs
NCBI-ProteinID: ATC85164
UniProt: A0A290RY13
LinkDB All DBs
Position
I:436330..436812
Genome map
AA seq 160 aa AA seqDB search
MGAGKSTIGRHIADQLHLEFVDSDQEIERRTGADIAWVFDLEGEEGFRLREESVIGDLTE
MQGIVLATGGGSVMSKEVRNKLSARGIVVYLETPIEKQVARTQRDKRRPLLQTEEAPRNV
LERLAEEREPLYKEVADFVVRTDEQSAKVVANQIIEKLDF
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgggggctggcaaaagcacgattggtcgtcacatcgctgaccaattacaccttgaattt
gttgattctgatcaagaaatcgaacgccgcacaggtgcagatattgcatgggtattcgat
cttgaaggtgaagaaggctttagacttcgagaagagtctgttattggcgatttaaccgag
atgcaaggtattgtacttgctaccggtggtggttcagtaatgagcaaagaagttcgaaac
aagctttcggctcgaggtatcgttgtatacctagagacacctatagagaagcaagttgca
cgcacgcaacgcgacaagcgtcgcccattactgcaaactgaagaagcacctcgtaacgta
ctagagcgcttagcagaagaacgcgagccactatacaaagaagttgctgattttgttgta
cgtaccgatgagcaaagcgctaaagttgttgctaaccaaatcatcgagaaattagatttt
taa

DBGET integrated database retrieval system