KEGG   Pseudoalteromonas arctica: PARC_a2148
Entry
PARC_a2148        CDS       T05179                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
part  Pseudoalteromonas arctica
Pathway
part00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:part00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PARC_a2148
Enzymes [BR:part01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PARC_a2148
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PARC_a2148
    1.1.1.-  
     PARC_a2148
SSDB
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C Pyr_redox_2 AdoHcyase_NAD HI0933_like XdhC_C Pyr_redox NAD_binding_7 3HCDH_N
Other DBs
NCBI-ProteinID: ATC86671
UniProt: A0A290S6N9
LinkDB
Position
I:complement(2067352..2068374)
AA seq 340 aa
MQAAQYIGNKSFNIVEGTSIKPKAGEIRLSVGYVGICGTDMHIYHGAMDQRVSIPQTIGH
EISGVVAEIGEGVEGFAVGENVVVRPLDWCGDCPTCNAGHTHICQNLKFMGIDTPGAFQS
SWTVKARTLHKLPAGVDLKQGALIEPLSVACHDVRRSRLQAGEKVVVLGGGPIGQLVAAV
AKSVGAEVLVSEPNKSRRAFADELGVKSVNPIEEDLAAYVDSWTQTKGADVVFEVSGVKP
AIEAMTEIAGRRGRIVMVAIHSVKPEIDLFQFFWKELELLGARVYEAADFDWAIELISSG
QIDLKPFISSVSSLTDIGSAFASMDGNPEGMKALVECNPQ
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcaagctgcacaatatataggtaacaagtcatttaacattgttgaaggcacatctatt
aaacctaaagcgggtgagattagattgagtgttggatacgttgggatttgcggtactgat
atgcacatataccatggtgcgatggatcaacgagtgtctattccgcaaacaattggccat
gaaatatcaggtgttgttgcagaaataggtgaaggcgttgaaggctttgctgtaggggaa
aacgtggtagtacgcccattagattggtgtggcgattgtcctacgtgtaatgcagggcat
acgcatatttgtcaaaacttaaagtttatgggaatagatacaccaggtgcttttcagtca
agctggacagttaaagcgcgtactttgcataaattaccagcaggcgttgatttaaaacaa
ggcgcattaatagagcctttatcggttgcgtgccatgatgtacgacgctcgcgcttacaa
gcgggtgagaaagtggttgtacttggtggcgggccaattgggcaattagttgctgcggtt
gctaaaagtgttggtgcagaagtactcgtgtctgagcctaacaaaagccgccgtgctttt
gccgatgagctaggtgttaaatcggttaatcccattgaagaagatttagctgcctatgta
gatagttggacacaaacaaaaggtgcagatgttgtatttgaagtatcaggcgtaaaaccc
gcaatagaggctatgaccgaaatagcagggcgtcggggtcgtatagtaatggtggctatt
cacagtgttaaacctgaaatcgatttatttcaattcttttggaaagagttggagttatta
ggtgcacgtgtatacgaagcggccgattttgattgggctatcgaattaatttcatcgggc
caaatagatcttaaacctttcattagttcggttagttcgttaactgatattggtagtgca
tttgcgagtatggatggaaatccagaaggcatgaaagcgcttgttgaatgtaatccacaa
taa

DBGET integrated database retrieval system