KEGG   Pseudoalteromonas arctica: PARC_a2148Help
Entry
PARC_a2148        CDS       T05179                                 

Definition
(GenBank) hypothetical protein
Organism
part  Pseudoalteromonas arctica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C Pyr_redox_2 AdoHcyase_NAD HI0933_like XdhC_C Pyr_redox F420_oxidored NAD_binding_7 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ATC86671
UniProt: A0A290S6N9
LinkDB All DBs
Position
I:complement(2067352..2068374)
Genome map
AA seq 340 aa AA seqDB search
MQAAQYIGNKSFNIVEGTSIKPKAGEIRLSVGYVGICGTDMHIYHGAMDQRVSIPQTIGH
EISGVVAEIGEGVEGFAVGENVVVRPLDWCGDCPTCNAGHTHICQNLKFMGIDTPGAFQS
SWTVKARTLHKLPAGVDLKQGALIEPLSVACHDVRRSRLQAGEKVVVLGGGPIGQLVAAV
AKSVGAEVLVSEPNKSRRAFADELGVKSVNPIEEDLAAYVDSWTQTKGADVVFEVSGVKP
AIEAMTEIAGRRGRIVMVAIHSVKPEIDLFQFFWKELELLGARVYEAADFDWAIELISSG
QIDLKPFISSVSSLTDIGSAFASMDGNPEGMKALVECNPQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctgcacaatatataggtaacaagtcatttaacattgttgaaggcacatctatt
aaacctaaagcgggtgagattagattgagtgttggatacgttgggatttgcggtactgat
atgcacatataccatggtgcgatggatcaacgagtgtctattccgcaaacaattggccat
gaaatatcaggtgttgttgcagaaataggtgaaggcgttgaaggctttgctgtaggggaa
aacgtggtagtacgcccattagattggtgtggcgattgtcctacgtgtaatgcagggcat
acgcatatttgtcaaaacttaaagtttatgggaatagatacaccaggtgcttttcagtca
agctggacagttaaagcgcgtactttgcataaattaccagcaggcgttgatttaaaacaa
ggcgcattaatagagcctttatcggttgcgtgccatgatgtacgacgctcgcgcttacaa
gcgggtgagaaagtggttgtacttggtggcgggccaattgggcaattagttgctgcggtt
gctaaaagtgttggtgcagaagtactcgtgtctgagcctaacaaaagccgccgtgctttt
gccgatgagctaggtgttaaatcggttaatcccattgaagaagatttagctgcctatgta
gatagttggacacaaacaaaaggtgcagatgttgtatttgaagtatcaggcgtaaaaccc
gcaatagaggctatgaccgaaatagcagggcgtcggggtcgtatagtaatggtggctatt
cacagtgttaaacctgaaatcgatttatttcaattcttttggaaagagttggagttatta
ggtgcacgtgtatacgaagcggccgattttgattgggctatcgaattaatttcatcgggc
caaatagatcttaaacctttcattagttcggttagttcgttaactgatattggtagtgca
tttgcgagtatggatggaaatccagaaggcatgaaagcgcttgttgaatgtaatccacaa
taa

DBGET integrated database retrieval system