KEGG   Pseudoalteromonas arctica: PARC_a2295Help
Entry
PARC_a2295        CDS       T05179                                 

Definition
(GenBank) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
part  Pseudoalteromonas arctica
Pathway
part00500  Starch and sucrose metabolism
part01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:part00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PARC_a2295
Enzymes [BR:part01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PARC_a2295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 Asp_protease TPR_6 LPAM_1
Motif
Other DBs
NCBI-ProteinID: ATC86797
UniProt: A0A290S5J7
LinkDB All DBs
Position
I:complement(2219432..2221837)
Genome map
AA seq 801 aa AA seqDB search
MKKYNLITTALLTLGLTACGAQNTNNENIDATVSAAPGAPGAEPYWAYAGKTGIGTSFEQ
YQNGQYNNNAATGEVSKVWFSIAKGMITETMFGLIHQAQIKDMQFVVTGKDFTVTEADDL
DVTIDYLHKDDKGRPLSLAYKVTSTDKKGRFTLEKHIFTDPDGQTLFVRSIFNTSLKGVK
AYVAVNPYINNNGLGDFAKTTEQGLVAWEDDNFLTLQSSTPFKMQSVGFTGVSDGITSLK
KQHTLSKKYSNTGDKAGNVTLLAELGNIDSNTTFDLALSFGKTQQQSQQQGAQSLSKGYQ
NVLDAYNGKGEALGWEDYLQSLEPLNTMVKQTADDGKLLYTSAMVLKAQEDKTNAGALIA
SLSNPWGETVSAKEGSTGYKAVWVRDFYQVAMAFMALGDTATAKTAFEYLEKVQVTSKTP
GNNGDTGWFLQKTHVDGELEWVGVQLDQTAMPIMLAWKLHQANVLSDNELKDWYARMLKP
AADFLVDGGRAKILWNDMQITPPATQQERWEEQSGYSPSTTAAVVAGLITASDIATLSGD
TQNADRYLATAKKYNSNIESQMFTTEGNLKGDSTDGEYFIRIGQDTDANSNTKINANNGR
EGFNKKQILDGGFLELVRYGVRSANDSSIVKTLPEYDDETLEDNLQVKYSFNFTDGSGTF
AGYRRYGNDGYGEDETTGTNYAESGSNTPGQRGRVWPFFTGERGHYEIAAANANNTLDDA
KQADIKNSYVKGLEQFANSGMMLPEQVWDGVGVNKAGYELGEGTNSATPLAWTHAEYIKL
VRSLSDKQVWDYYPVVAESLN
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatataaccttattactaccgctcttttaactttgggcttaacagcctgtggt
gcacaaaatacgaataacgaaaatattgacgctacagtttcagcagctcctggcgcacca
ggtgctgaaccatattgggcttacgcgggtaaaaccggaattggtacttcttttgagcaa
taccaaaacggccaatataataacaatgctgcgacaggtgaagtatcaaaagtatggttt
tcaattgccaaaggtatgatcaccgaaactatgtttggactcattcaccaagctcaaatt
aaagatatgcagtttgtagtaaccggtaaagattttacagtcactgaagctgacgactta
gacgttacaattgattacttacataaagacgataaaggcagaccactatcgcttgcttac
aaagtaacaagtacagataagaaagggcgttttaccctcgaaaaacacatattcaccgac
cctgacggacaaacattgtttgtacgcagtatttttaatacatcacttaaaggcgtgaaa
gcgtatgttgctgttaatccttatataaacaacaacggcttaggtgattttgcaaaaacc
actgagcaaggcttagtagcatgggaagatgataattttttaacgttgcaatcatctacg
ccattcaaaatgcaaagtgtaggctttacaggtgtgagcgatggcatcacctcacttaaa
aaacaacacacactaagcaaaaaatattcaaacaccggcgataaggccggtaatgtcact
ctgctggcagagcttggtaatatcgatagtaataccacatttgatttagcactaagcttt
ggtaaaacgcagcagcaaagccagcaacaaggtgcacagagcttatctaaaggttatcaa
aatgtgcttgatgcctacaacggtaaaggtgaagcgctaggctgggaagattatttacaa
agccttgaaccattaaatacaatggttaagcaaacagccgatgacggtaaattgctttac
accagtgcaatggtactaaaagcgcaagaagacaaaactaatgcgggtgcgctcattgcc
tcactttctaatccttggggtgaaactgtttcagccaaagagggttcgactggttacaaa
gcagtatgggttcgtgatttttatcaagtagctatggcatttatggccttaggcgataca
gcgactgcaaaaacggccttcgaataccttgaaaaagtacaagttactagcaaaaccccg
ggtaacaatggtgatacaggatggtttttacaaaaaacacatgttgatggtgaacttgaa
tgggtaggggtacagctagatcaaacggctatgccaattatgcttgcgtggaagttacat
caagcaaacgtactcagtgataacgaacttaaagattggtacgcacgcatgctaaaaccg
gcagctgactttttagttgatggcggaagagctaaaattttatggaacgacatgcaaatc
actccacctgcaacacagcaagagcgctgggaagagcaaagtggttattctccctctaca
acggctgccgttgttgctggccttataacagccagtgacatagcaacactcagtggtgat
actcaaaatgcagatcgttatttagcaacggctaaaaagtacaacagtaatatagaatcg
caaatgtttaccaccgaaggtaatttaaaaggcgatagcaccgatggcgagtattttatt
cgtatcggtcaagacaccgacgctaactctaatactaaaattaacgccaacaatggccgt
gaaggttttaacaaaaagcagattttagacggtggttttttagaattagtccgctatgga
gtaagaagtgccaacgattcaagtatagttaaaaccctgcctgagtatgacgacgaaacg
cttgaagataacttacaagttaaatacagctttaactttaccgatggtagcggcacattt
gcaggctatcgccgttatggcaacgacggttacggtgaagatgaaaccacaggtactaat
tacgccgaaagcgggagcaatacgccaggccaacgtggtcgtgtatggccattttttaca
ggcgaacgcggacactatgaaatagcggccgcaaacgcaaataatacgctagatgatgca
aaacaagcggacattaaaaatagttacgtaaaagggctagagcaatttgctaatagcgga
atgatgctacctgagcaagtatgggatggcgttggcgtaaataaagcaggttatgaatta
ggcgagggcacaaactcagcaacacctctggcttggacacacgcagaatacatcaagctt
gtacgctcactcagtgataaacaagtttgggactattatccggtggttgccgagtctctt
aattag

DBGET integrated database retrieval system