KEGG   Pseudoalteromonas arctica: PARC_a2553Help
Entry
PARC_a2553        CDS       T05179                                 

Definition
(GenBank) peptidyl-dipeptidase A
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
part  Pseudoalteromonas arctica
Brite
Enzymes [BR:part01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     PARC_a2553
Peptidases [BR:part01002]
 Metallo Peptidases
  Family M2
   PARC_a2553
Exosome [BR:part04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PARC_a2553
CD molecules [BR:part04090]
 Proteins
  PARC_a2553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 Reprolysin_5
Motif
Other DBs
NCBI-ProteinID: ATC87031
UniProt: A0A290S7P7
LinkDB All DBs
Position
I:2498051..2499898
Genome map
AA seq 615 aa AA seqDB search
MTPFRFKLSMSALMVASTLALTACDAQVTIDTTNSAHTKKAVTAKDANTFITNTEKELSA
LYLESSRAEWIYANFITHDTSALSAEVNRKMTETVVRLANEAAKYDELELDYDARRKLDK
LKLALTLPAPQDADKTAQLSQIVAELGGLYGKGKYCKEDGTCLSLGDMTSKMATSRDYNE
LLDLWQGWRQISKPMRSLYEQQVVLTNEGAKELGYADTGAMWRSKYDMPADDFTTELDRI
WGQVKPLYNSLHCHVRAKLGEKYGTDKVPQDQPIPAHLLGNMWAQAWGNIYDVVAPENAD
PGYDVTELLAQNNYDELKMVKGAENFFTSMGFDALPETFYERSLFVKPKDRDVQCHASAW
NIDSKDDLRIKMCIQRTGEEFSVIHHELGHNFYQRAYNKQPLFYQESANDGFHEAIGDTI
ALSVTPGYLKEIGLLEQVPDESKDIGLLMKMALDKVAFVPFSLMVDQWRWQVFSGEVVPE
NYNKAWWELREKYQGVQAPIARSENDFDPGAKYHVPGNTPYTRYFLAHILQFEFHRSLCE
IAGNDKAIHRCSIYNSKEAGDKLNAMLEMGSSRPWQEALETVTGKPQMDATAMLDYFAPL
QTYLDKQNEGRNCGW
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgaccccctttcgatttaaactaagtatgagcgccttaatggtagcaagtactcttgct
ttaacagcctgcgatgcgcaagtaacgatagacactaccaattcagcacacactaaaaaa
gctgtaacagctaaagatgcaaatacatttataacaaacacagaaaaagaactaagtgca
ctttatttagaatcgagccgtgcagaatggatttacgcaaactttattactcatgatacg
tcggctctatcggctgaagttaaccgtaaaatgaccgaaacagtcgtgcgtttagcaaat
gaagctgcaaaatacgacgaactagagcttgattacgatgctcgccgtaagcttgataaa
ctaaagctcgcacttacacttcctgccccacaagacgctgataaaacagcacaactttca
caaattgtcgcagagcttggcgggctatacggtaaaggtaaatactgtaaagaagacggc
acctgtttaagccttggcgacatgacttcaaaaatggctaccagccgagattacaacgaa
ctacttgatttatggcaaggctggcgtcaaatatcaaaaccaatgcgctcactttacgag
caacaagtagtgctgaccaacgaaggtgcaaaggagcttggttatgccgatacgggcgct
atgtggcgcagtaaatatgatatgcctgctgatgacttcaccaccgagcttgaccgtatt
tggggccaagttaaaccactgtataactcgctacactgccatgttcgcgcaaagttaggt
gaaaagtacggcaccgacaaagtacctcaagatcagccaataccagcgcacttacttggt
aatatgtgggcgcaagcatggggtaatatttacgatgtagttgcaccagaaaacgccgat
ccgggttacgacgtaaccgagttattagctcaaaataattacgacgaacttaaaatggta
aaaggggctgaaaacttttttacctcaatgggttttgacgcactaccagagacattttac
gagcgttcactgtttgtaaaaccaaaagacagagatgtgcagtgtcatgcatcagcatgg
aatatcgatagcaaagacgatttacgcattaaaatgtgtattcagcgcacaggcgaagag
ttttcagttattcaccatgaattaggtcataacttttatcaacgcgcttataataaacaa
cctttattttatcaagaaagtgcaaacgatggttttcatgaagccattggtgacaccatt
gccttatcggttacgccgggttacttaaaagaaatcggcttacttgaacaagtacctgat
gaatctaaagatattggtttattaatgaaaatggcacttgataaagtcgcctttgtgccg
tttagcttaatggttgatcagtggcgctggcaggtattttcaggagaagtagtaccggaa
aattacaataaagcatggtgggaactacgtgaaaaataccaaggagtgcaagctcctatc
gcacgtagcgaaaatgattttgatccgggtgctaagtaccacgttccgggtaacacgcct
tatactcgttactttttagcgcatattttacaatttgagtttcatcgcagcttatgtgaa
attgccggtaacgataaagccattcatcgctgctctatttataactcaaaagaagcaggg
gataagctaaacgctatgcttgaaatgggttcgtctcgcccttggcaagaggcgcttgaa
actgtaacaggtaagccgcaaatggatgcaacagcaatgctcgattactttgcaccatta
caaacatatttagataaacaaaacgaaggccgcaactgcggctggtaa

DBGET integrated database retrieval system