KEGG   Pseudoalteromonas arctica: PARC_a2802Help
Entry
PARC_a2802        CDS       T05179                                 

Gene name
fabB
Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
part  Pseudoalteromonas arctica
Pathway
part00061  Fatty acid biosynthesis
part00780  Biotin metabolism
part01100  Metabolic pathways
part01212  Fatty acid metabolism
Module
part_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:part00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PARC_a2802 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PARC_a2802 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:part01004]
    PARC_a2802 (fabB)
Enzymes [BR:part01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     PARC_a2802 (fabB)
Lipid biosynthesis proteins [BR:part01004]
 Fatty acid synthase
  Component type
   PARC_a2802 (fabB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc CaMKII_AD
Motif
Other DBs
NCBI-ProteinID: ATC87251
UniProt: A0A290S8B6
LinkDB All DBs
Position
I:complement(2736996..2738207)
Genome map
AA seq 403 aa AA seqDB search
MRRAVITGIGVVSSIGNNKEEVLESLKTGKSGIAFNQEFADYKLRSNVSGKIDIDVKAHV
DRKAMRFMGDAAAYSYISMTQAIEDSGLSDDQVSNERTGIIVGSGGGSSKWQVEAADILR
EKGVKRVGPYMVPRTMASTTSACLATPFKIKGVNYSISSACATSAHCIGNAVEQIQLGKQ
DVVFAGGGEELHWTLAMEFDAMGALSTKYNETPEKASRTYDANRDGFVISGGGGIVVVEE
LEHALARGAHIYAEIVGYGATSDGYDMVAPSGEGAARCMRQAMQDVDSIDYLNTHGTSTP
VGDVKELGAIQEVFGGKSPMISATKAMTGHALGAAGVHEAIFSLLMLEHSFVAPSINIDE
LDEQAAGLDIITERRDVELNTVMSNSFGFGGTNATLVMSKYKG
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagaagagctgtaattacaggtatcggtgttgtatcaagcattggtaacaacaaagaa
gaagtattagaatcgttaaaaacgggcaaaagcggtatcgcttttaaccaagaatttgcc
gattataagttacgtagtaacgtatcgggtaaaattgatattgacgttaaagcacatgtt
gaccgcaaagcaatgcgctttatgggtgatgctgctgcatattcttatatttcgatgact
caagcaattgaagactcaggtttgtctgacgaccaagtatcaaatgagcgcacgggtatt
attgttggctctggcggtggttcgtctaaatggcaggtagaagctgctgatattttacgt
gaaaaaggcgtaaaacgtgtagggccttatatggttccacgtactatggcgagcactaca
tctgcttgtttagcaacaccctttaaaattaaaggtgttaactactcaattagctctgca
tgtgcaacatctgcgcattgtattggtaatgcagtagaacaaattcaattaggtaagcaa
gatgttgtttttgctggtggcggtgaagaactacactggacattggcaatggaatttgac
gctatgggcgcactttctactaagtacaacgaaacaccagaaaaagcgtctcgtacatac
gatgcaaatcgcgatggttttgttatatctggcggcggcggtattgttgtagttgaagaa
cttgaacatgcacttgcacgtggcgcgcacatttacgctgaaattgttggttacggtgca
acatcagatggctacgacatggttgctccatctggcgaaggtgcagcacgttgtatgcgc
caagctatgcaagatgtagacagcattgattacttaaacacgcatggtacatctacacct
gtaggcgacgttaaagagcttggtgcgattcaagaagtgtttggtggtaagtcaccaatg
atcagcgcaactaaagcaatgacgggtcatgccctcggtgctgcaggtgttcacgaagct
atcttttcattattaatgctagagcacagctttgtagcgccttcaattaatattgatgag
ctagatgagcaagcggcaggtttagatattattactgaacgtcgtgacgttgagttaaat
actgtaatgtctaatagctttggctttggtggcacaaacgcgactttagttatgagtaag
tacaaaggttaa

DBGET integrated database retrieval system