KEGG   Pseudoalteromonas arctica: PARC_a3086Help
Entry
PARC_a3086        CDS       T05179                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
part  Pseudoalteromonas arctica
Pathway
part00250  Alanine, aspartate and glutamate metabolism
part00410  beta-Alanine metabolism
part00430  Taurine and hypotaurine metabolism
part00650  Butanoate metabolism
part01100  Metabolic pathways
part01110  Biosynthesis of secondary metabolites
part01120  Microbial metabolism in diverse environments
part02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:part00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PARC_a3086 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PARC_a3086 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PARC_a3086 (gadB)
   00430 Taurine and hypotaurine metabolism
    PARC_a3086 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PARC_a3086 (gadB)
Enzymes [BR:part01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PARC_a3086 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ATC87506
UniProt: A0A290S5Y7
LinkDB All DBs
Position
I:complement(3019549..3021174)
Genome map
AA seq 541 aa AA seqDB search
MDQKRCAVASKESLKRIFTVPEAPDSTLSKIELEISSNLAGFLNENIAAIEKPLHEIEKD
FQSAVIPEDPTFVSAYAQDIMEQLVAHSVHTAAPSFIGHMTSALPHFLLPLSKLMVGLNQ
NLVKIETSKAFTPLERQVLGMMHHLAYGQEDSFYSKWMHSAKTSLGAFCSGGTVANITAL
WIARNRLLKPDGDFRGIGAQGLIAGMLHYGYKGLAVLISERGHYSLGKSVDLLGIGRDNL
IGIKTCENNKVDVGAMREKARELESQGIKVMAIIGVAGTTETGNIDPLDEMADLAQDINC
HFHVDAAWGGATLLSNTHRPLLKGIERADSITIDAHKQMYVPMGAGLVLFKDPAATDAIE
HHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLRVIGRKGYEMLIDRSIKKAHYFADLI
KADEDFELISEPELCLLTYRYVPKKIKQAIADADAATRLDIFASLNRFTASMQKRQRESG
RSFVSRTRLTPSKYDNQPTVVFRVVLANPLTSGAILKEILAEQKELAATDPVFKKYLRKY
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaagcgttgtgccgtcgcctctaaagaaagccttaagcgtatatttactgta
cctgaagcgccagactcaactttaagcaaaatcgagcttgaaatttcgagtaatttagca
ggttttctaaacgaaaatatagcggcaattgaaaaaccattacatgaaatcgaaaaagat
tttcagtcggcagtgatcccagaggatccaacgtttgtatctgcttatgcccaagacata
atggagcaacttgttgcgcattctgtacatacagctgcgcctagctttattggtcacatg
acctctgccttgccgcattttttattacctctgtcaaaattgatggtagggctaaatcaa
aatctagtaaaaatagaaacgtctaaagcgtttacgcctcttgaacgtcaagtgcttgga
atgatgcatcatttagcttatgggcaagaagattcattttattctaaatggatgcacagt
gctaaaacctcactaggtgcattttgctctggtggaacggttgctaatattactgcgctt
tggattgctcgaaaccgcttattaaaacccgatggcgattttagaggtatcggcgcacaa
ggcctaattgccggtatgctgcattacggctataaaggtttagcagtattaatatcagaa
cgcggacattactcattaggtaaatcggttgatttactcggtattggccgcgataactta
attggtattaaaacctgcgaaaataataaagttgatgtaggagctatgcgcgaaaaagca
cgtgagcttgaatcgcaaggcattaaagtaatggcgattattggggtagcgggtacaacc
gaaaccggtaatattgacccacttgatgaaatggctgacttagcacaagacattaactgc
cattttcatgtagatgctgcatggggaggagcaacccttttatcgaacacgcatcgccct
ttactaaaagggattgagcgagcagattcaattaccatcgatgcacataaacaaatgtat
gtaccaatgggagcgggtttggttttatttaaagatcccgctgcaactgatgcaatagag
catcacgctgagtacatattacgtaaaggttcaaaagacttaggtagccacacgcttgaa
ggcagccgacctggtatggcaatgttagtacatgcttgcttacgtgttattggtcgtaaa
ggttacgaaatgctgattgatcgaagcatcaaaaaagcacattactttgctgatttaatt
aaagctgatgaagactttgagcttatttcagaacctgaattgtgcttattaacgtatcgt
tatgtacctaagaaaattaaacaagcaatagctgatgcagatgctgcaactcggttagat
atttttgcctctctgaatcgttttactgccagtatgcaaaaacgtcagcgagagtctggt
cgctcatttgtatcacgtactcgtttaacgccttctaaatacgacaatcaacctacagtt
gtatttagagtggtacttgcaaacccgcttacatcaggcgctattttaaaagagatatta
gctgagcaaaaagagttggctgcaacagatccggtattcaaaaaatacctaagaaagtat
atgtaa

DBGET integrated database retrieval system