KEGG   Pseudoalteromonas arctica: PARC_b0405Help
Entry
PARC_b0405        CDS       T05179                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
part  Pseudoalteromonas arctica
Brite
KEGG Orthology (KO) [BR:part00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PARC_b0405 (ahpF)
Enzymes [BR:part01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PARC_b0405 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO FAD_oxidored NAD_binding_8 Thi4 FAD_binding_3 K_oxygenase NAD_binding_9 Glutaredoxin Lycopene_cycl Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: ATC88609
UniProt: A0A290S9P9
LinkDB All DBs
Position
II:379797..381371
Genome map
AA seq 524 aa AA seqDB search
MLDNNIKNQLKSHFESLTQPVELLIALDDSKKSAEVESLANDLASLSDKFTVMNNPDTSA
RRPSMVVHSPIKNTHITFAGVPMGHEFTSLVLALLHTGGHASKAKSEDIEQIQSLTQELN
FEVYISLSCQTCPQVVQALNTMAATNSNIKATMIDGALFQDEVEERNILAVPAVYLNGEP
FSQGALSLTDILNKVDSKGAQRQAQSLSKKDKFDVLVIGGGPAGASAAIYSARKGLNTGI
VADRFGGQVADTLAIENFISIKATEGPKLVAQLEEHVKEYDVDVMHNQRAAALGYNNGYE
ITLENGAVLKAKSLVLATGARWREMNVPGEQEYRGHGVAYCPHCDGPLFKGKPVAVIGGG
NSGIEAAIDLANIVQSVTVLEFADTLRADEVLIRKAKSMANITIIKSAQTTEVLGDGKKV
TGLMYTDRVSGESKELELAGIFVQIGLIPNTEWLKDSDLELSKFGEILIDAKGATSLPGI
YGAGDATNTPFKQIIIAMGSGATASLGAFDYLIRHSEEADQSAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttagataacaacataaaaaatcaattaaaaagccattttgaatcgcttactcaacct
gttgagctgcttattgccttggatgacagcaaaaaatcagcagaagtagaaagcttagcg
aacgatttagcctcactgagcgataaatttacggtaatgaacaatcctgatacaagcgcg
cgtcgcccgtcaatggttgtgcattcacctattaaaaacactcatattacgtttgcaggc
gtacctatgggccacgaattcacaagtttagtgctagcacttttacatactggcggacac
gcaagtaaagctaaaagcgaagacattgaacaaatacaatcgcttactcaagaacttaac
tttgaagtatatataagtttaagttgccaaacgtgcccgcaagtagtccaagcacttaat
actatggcagcgacaaacagcaatattaaagcgaccatgattgatggcgcattatttcaa
gatgaagtagaagagcgaaatattttagctgtaccggctgtatatttaaatggcgaacca
tttagccaaggtgcactaagccttaccgacatactcaataaagtagatagcaaaggggca
cagcgccaagctcaatcgctaagtaaaaaagataaatttgatgtacttgtaattggtggc
gggcctgcgggcgcatcggctgcgatttactcagcacgaaaagggttaaatacaggtatt
gttgccgacagatttggtggacaagttgcagatacattagcaatagaaaactttatttcg
attaaggcgactgaagggccaaaattggttgcccagcttgaagagcacgttaaagaatac
gatgtagatgtaatgcataatcagcgtgcagcggcacttggttataacaatggctacgaa
attacacttgaaaatggcgcagtactcaaagctaagtcgctcgtacttgccactggtgca
cgctggcgcgaaatgaacgtaccaggggagcaagaatatcgcggccatggtgtggcatat
tgcccacattgtgatggccctttatttaaaggtaaacctgttgccgtaattggcggtggt
aattcgggtatagaagcagcaatcgatttagctaatattgtgcaaagcgttacggtactt
gaatttgcagacacactacgtgctgatgaagtgcttattcgtaaagctaaaagcatggct
aatattaccattatcaaaagtgcacaaactaccgaagtacttggcgatggtaaaaaagta
actggcttaatgtacaccgatagagtgtccggagagagcaaagagcttgaacttgccggt
atatttgtacaaataggcttaataccaaataccgaatggttaaaagacagcgaccttgaa
ttaagcaaatttggtgaaatactgattgatgctaaaggcgcaacgtcactaccaggaatt
tacggcgcgggggatgcaaccaatactccgtttaaacaaattattattgcaatgggcagc
ggtgcaacagcaagtttaggtgcatttgattatttaattcgtcactctgaagaagctgat
caaagcgctgcttaa

DBGET integrated database retrieval system