KEGG   Paracoccus sp. CBA4604: CYR75_01495Help
Entry
CYR75_01495       CDS       T05276                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
paru  Paracoccus sp. CBA4604
Pathway
paru03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:paru00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    CYR75_01495
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:paru03400]
    CYR75_01495
Enzymes [BR:paru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     CYR75_01495
DNA repair and recombination proteins [BR:paru03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     CYR75_01495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG DEC-1_N
Motif
Other DBs
NCBI-ProteinID: AUM73139
UniProt: A0A2K9MBW4
LinkDB All DBs
Position
complement(289697..290551)
Genome map
AA seq 284 aa AA seqDB search
MESRLTWQGVEIDGPTALALLEWQREMGADEAMLDAALDRTDLPAPAAVAAAPPAPAAPA
AGVSAAAQAAPPVGAQQSLLGDDHAEALAQAEALAAGAATLDALAAAQQGFDGIELKRGA
RNFVFADGRAAARVMILGEAPGEEEDARGLPFVGRAGQLLDQMFAAIGMGRADPDATRAL
YVTNVIKWRPTGNRRPTAEEIALSLPFLRRQVELADPEFLVLMGNTPCAAALGREGILRL
RGNWTTAFDRPALPMTHPAYLLRNPVAKRESWADLLSLAAKLGL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgcgtctgacatggcagggggtcgagatcgacggcccgaccgcgcttgcgctg
cttgaatggcagcgcgagatgggcgcggatgaggcgatgctggacgcagcgctcgaccgc
accgacctgcccgcgcctgccgcggtggcagcggccccgcctgcgcctgctgccccggcg
gcgggcgtgtcagccgcagcgcaggccgcgccgccggtcggggcgcagcaaagcctgctg
ggtgatgaccatgcggaggctttggcgcaggcagaggcgctggcggccggggcggcaact
ctggacgccctcgctgccgcgcagcagggcttcgacgggatcgagttgaagcgcggggcg
cggaacttcgtctttgccgatggacgggcggcggcccgcgtgatgatcctgggcgaggcg
ccgggcgaagaggaggacgcgcgcggcctgccctttgtcgggcgtgccgggcagttgctg
gaccagatgttcgccgccatcggcatgggccgcgccgatcccgacgcgacgcgcgcgctc
tatgtcaccaatgtcatcaaatggcgcccgaccggcaaccgccgccccacggccgaggaa
atcgcgctgtccctgccctttctgcgccggcaggtcgagcttgccgaccccgaattcctg
gtgctgatgggcaatacgccctgcgccgcggcattgggacgcgagggcatcctgcgtctg
cgcggcaattggaccacggcgtttgaccgcccggcgctgccgatgacgcatccggcctat
ctgctgcgaaacccggtcgccaagcgcgagtcctgggcggacctgctgtcgctggccgcg
aagctggggctttag

DBGET integrated database retrieval system