KEGG   Paracoccus sp. CBA4604: CYR75_02665Help
Entry
CYR75_02665       CDS       T05276                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
paru  Paracoccus sp. CBA4604
Pathway
paru00061  Fatty acid biosynthesis
paru00780  Biotin metabolism
paru01100  Metabolic pathways
paru01130  Biosynthesis of antibiotics
paru01212  Fatty acid metabolism
Module
paru_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:paru00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CYR75_02665
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CYR75_02665
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CYR75_02665
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:paru01004]
    CYR75_02665
Enzymes [BR:paru01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CYR75_02665
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CYR75_02665
Lipid biosynthesis proteins [BR:paru01004]
 Fatty acid synthase
  Component type
   CYR75_02665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AUM73341
UniProt: A0A2K9MCH1
LinkDB All DBs
Position
complement(528087..528875)
Genome map
AA seq 262 aa AA seqDB search
MGDLLKNKRGLIMGVANERSIAWGIARAMAAQGAELAFSYQGDMFAGRVKPLAESVGSDL
LIDVDVTDDDSLAAAFQRIGNDWGRLDFVVHAIAYSNKDELTGRFVDTSRENFKNSLDIS
CYSLIDVARRAHPLMGPGSSILTLTYGGSNRVTPFYNVMGVAKAALEASVRYLANDLGPD
GIRVNAVSPGPMKTLAGAAIGGARKTFRHTQANAPLRANATLEAIGGTAVWLTSEWGACT
TGEIVTVDGGYHVLGMPQSENL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggagatctgctgaagaacaagcgcgggctgatcatgggcgtcgcgaatgaacgctcg
attgcctgggggatcgcgcgggccatggcggcgcagggggcggaactggccttcagctat
cagggcgacatgttcgcggggcgggtcaagccgctggcggaatcggtcggctccgacctg
ctgatcgacgtcgatgtgaccgatgacgacagcctcgccgcggcgtttcagcggatcggc
aatgactgggggcggctggatttcgtcgtccacgccatcgcctattccaacaaggacgag
ctgaccggccgctttgtcgacaccagccgagagaacttcaagaattcgctcgatatctct
tgctattcgctgatcgacgtggcgcgccgcgcgcatccgctgatggggccgggcagctcg
atcctgacgctgacctatggcgggtcgaaccgggtcacaccgttttataacgtgatgggc
gtggccaaggccgcgctcgaggcgtcggtgcgctatctggccaacgatctcggccccgac
ggcatccgcgtcaacgcggtcagcccgggcccgatgaaaacgctggccggggccgccatc
ggcggcgcgcgcaagaccttccgccacacccaggccaacgcgccgctgcgcgcgaacgcg
acgctcgaggcgatcggggggacggcggtctggctgaccagcgaatggggcgcctgcacc
acgggcgagatcgtgaccgtcgatggcggctatcacgtcctcggcatgccgcagagcgaa
aacctgtga

DBGET integrated database retrieval system