KEGG   Paracoccus sp. CBA4604: CYR75_08680Help
Entry
CYR75_08680       CDS       T05276                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
paru  Paracoccus sp. CBA4604
Pathway
paru00061  Fatty acid biosynthesis
paru00780  Biotin metabolism
paru01100  Metabolic pathways
paru01212  Fatty acid metabolism
Module
paru_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:paru00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CYR75_08680 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CYR75_08680 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:paru01004]
    CYR75_08680 (fabZ)
Enzymes [BR:paru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CYR75_08680 (fabZ)
Lipid biosynthesis proteins [BR:paru01004]
 Fatty acid synthase
  Component type
   CYR75_08680 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH MaoC_dehydrat_N
Motif
Other DBs
NCBI-ProteinID: AUM74332
UniProt: A0A2K9MFQ5
LinkDB All DBs
Position
complement(1783216..1783722)
Genome map
AA seq 168 aa AA seqDB search
MADTTPAEADIGLIQRMIPHRYPFLLIDRVRDIVPHKSGVGIKNVTINEPHFQGHFPGQP
VMPGVTIVEAMAQTAAVVVCASLDLADKGMKTYFMAIDKVKFRRMVVPGDVLELHVEARR
GGGRIWKFAGRAMVGDELACEAEFTAMMDQSATATSTADAPAAGRNDG
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaccacccctgccgaagccgatatcggcctgatccagcggatgatcccgcat
cgctatccgttcctgctgatcgaccgggtccgcgacatcgtgccccataaatccggggtc
gggatcaagaacgtcaccatcaacgagccgcatttccagggccatttccccggccagccg
gtcatgcccggcgtcaccatcgtcgaggcgatggcccagacggcggcggtggtggtctgc
gccagcctcgatctggccgacaaggggatgaagacctatttcatggccatcgacaaggtc
aagttccgccgcatggtggtgccgggcgacgtgctggaactgcatgtcgaggcgcggcgc
ggcggcgggcggatctggaaattcgccggccgcgccatggtcggcgatgaactggcctgc
gaggcggaatttaccgcgatgatggaccagtccgcgaccgcgacctcgaccgccgatgcc
cccgctgctggccgcaatgacggctga

DBGET integrated database retrieval system