KEGG   Paracoccus sp. CBA4604: CYR75_09345Help
Entry
CYR75_09345       CDS       T05276                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
paru  Paracoccus sp. CBA4604
Pathway
paru00240  Pyrimidine metabolism
paru01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paru00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CYR75_09345
Enzymes [BR:paru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CYR75_09345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30
Motif
Other DBs
NCBI-ProteinID: AUM74454
UniProt: A0A2K9MFT3
LinkDB All DBs
Position
1920392..1920967
Genome map
AA seq 191 aa AA seqDB search
MAKLYFHYSTMNAGKSTLLLQASYNYRERGMKTLLLIASLDDRAGDGVIGSRIGISAPAT
AFGPAQDLFALIAADPGPLSCVFVDEAQFLSADQVWQLARVADDLGIPVMAYGLRVDFRG
QLFPGSAALLALADDLREVRTICHCGRKATMVVRRDAQGRVQTAGAQVQVGGNETYLSLC
RRHWREAVGTA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctacttccattattcgaccatgaacgccggcaaaagcacgctgctcttg
caggcgtcctacaactaccgcgagcgcgggatgaagacgctgctgctgatcgcctcgctc
gacgaccgcgcgggcgacggggtcatcggctctcgcatcgggatcagcgcgccggccacg
gctttcggccccgcccaggatctctttgcgctcatcgccgccgatcccggcccgctctct
tgcgtgttcgtggacgaggcgcagtttctctcggccgatcaggtctggcagctggcgcgg
gtcgcggatgatctgggcattccggtcatggcctatgggctgcgcgtcgatttccggggc
cagctgttccccggctcggcggccctgctcgcgcttgccgacgatctgcgcgaggtccgc
accatctgccattgcgggcgcaaggcgaccatggtcgtgcgccgcgacgcgcaaggccgg
gtgcagaccgcaggcgcgcaggtgcaggtgggcgggaacgagacctacctctcgctctgc
cgccgtcactggcgcgaggcggtgggcacggcctga

DBGET integrated database retrieval system