KEGG   Muribaculum intestinale: A4V02_01475Help
Entry
A4V02_01475       CDS       T04438                                 

Definition
(GenBank) hypothetical protein
Organism
pary  Muribaculum intestinale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_dep_Rec Plug CarbopepD_reg_2 CarboxypepD_reg Big_1
Motif
Other DBs
NCBI-ProteinID: ANU62534
UniProt: A0A1B1S6W1
LinkDB All DBs
Position
complement(398482..401634)
Genome map
AA seq 1050 aa AA seqDB search
MKGITFVCLSFVFCLLTGTTHIYASENLADSINASAAQTVSTTVRGTVTDATGEPIIGAI
VKLSGASTGATDTDVSGQFTLSDVKYPSEIEVSYIGFNPVEMRLKEGTSRYTVVMHEIKS
TLDEVVVVGYATQRKVNLTGSVSSISASTLADRPLTNATNALAGLASGLTVTNAGGNTPG
YEAQTIRVRGQGTLNDAAPLVVVDGMTGIAISDVNPQDIENISILKDAASSAIYGSRAAN
GVILITTRQGMESRPSVTYSGNISFETVAKRLNLVTDYADFMEIQNAGLIANGQAPRFSQ
GKIDEWRNDAGRNPTIYPNTDWHDHIYRNPSVVQNHNVSLTGGSKRVRYNMSFGYVDNPG
MIYHTDYSRYQLRTNLEVNVKPWLTIGTNLFGYIDSNNPSADNATKGGDVIFGSGAFNTV
PGMTLYDPATGLYGGIQNPEEENVSNFNPYRRQWFYKDEFPTKTRRTVAKLFARIQPLKG
LVIQGSYSYNYWTRREEHHLTDRNLYRFTADGPVLIREGVVRTYIRRRNYANTFRSSEIT
AHYTLTKGKFEGTILLGASQEYNKYENESFLKYDLIDDSMTAIDGGTTNGNISGNYTEWA
MRSYFGRINLSWDDKYMLEANLRADGSSKFAPGHRWGYFPSVSAGWRISEESFMKATRSW
LDNLKLRASYGSLGNNATTSYYMYQSLFASANYILNGSITGGFAQSILSNQNLSWEKTYM
TNFGIDFGLFNNRLNGSFDIYDKNTKGILISLPAPLEHGTSTVPNQNAGEVNNRGLEFDI
NWSDRIGNVGYSVGFNMAYVRNKVTKFQGDVPSISGVYKTQEGRPINQLYVIKVDRIVRD
QADLDYVQSLVDRNPDYFATFQRPELGDFLYADTNGDGSLDNNDRVEIGKGTLPTFTYGA
SLGLTWKDFDFSLLLQGVGNHQVYYNNQAFRFVTVMGQSLIKDITDNAWTLENPYNSKYP
ILRNNSNAKNNIASDAFVHNAAYLRCKNIQLGYTVPRNITKKVYISNLKIYASIDNLFTI
TKFPGLDPEVGADVGYPAVRQYSLGINLTF
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaataacatttgtctgtctttcatttgtattctgcctcctcacaggaacaaca
cacatttacgcctctgaaaaccttgccgacagcatcaatgcatcggcggcacaaacggtg
tcgacaaccgtacgaggcactgtaaccgacgctaccggcgagcctataatcggcgcgatt
gtaaagctaagcggtgcttctacaggagccaccgataccgatgtgtctggacagttcaca
ctctctgatgtgaaatatccatcggagattgaagtgtcatacataggattcaatccggtc
gagatgcgcctgaaagagggcacatcgcgctacactgtggtaatgcacgagataaagtcg
acactcgacgaagtcgtagtcgtcggctacgcgacacagcgaaaagtcaaccttaccggc
tctgtgtcatcgataagcgcgtctacactcgccgaccggccgctcactaacgccaccaac
gcacttgccggactggcttcaggccttactgtcacaaatgccggaggaaatactcccggc
tacgaggcgcagacaatacgcgtgcgcggacaaggcactcttaacgacgccgcaccgctc
gtggtggtcgacggaatgaccggcatagccatcagcgatgtaaatccacaggatatcgag
aatatatccatcctcaaggatgccgcatcatcggctatctacggctcaagagcagccaac
ggcgtaatactcataaccacacgacaaggcatggagtcacgtccaagtgtgacatacagc
ggcaacatttcatttgagacagtagccaaacgcctcaacctcgtgaccgactatgccgat
ttcatggagattcagaatgccggtctgatagccaacggacaggcaccgcgtttctcacaa
ggcaaaatcgacgaatggcgcaacgacgccggccgcaatcccaccatatatcccaacacc
gactggcacgaccacatataccgcaacccctcggtggtgcagaaccataatgtatccctc
accggagggagcaagcgcgtacgctacaacatgtcgttcggatatgtcgacaatccgggc
atgatataccacaccgactactcccgctaccagctgcgcaccaatctggaagtcaacgta
aagccgtggctcacaataggcaccaacctcttcggatatatcgactccaacaatccgtcg
gccgacaacgccaccaaaggaggcgatgtgatattcggctcgggagcgttcaacactgta
cccggcatgactctctacgacccggcgaccgggctctacggaggcatacagaatccggaa
gaggagaatgtgagcaacttcaatccctacaggcgccagtggttctataaagatgaattc
cccacaaagacacgccgcaccgtggcaaaactttttgcccgcatccagccattgaaagga
cttgtgatacaaggctcttactcatataattactggacacgccgcgaggagcaccatctt
accgaccgcaatctatatcgctttacagccgacgggcctgtgctgatacgcgaaggcgta
gtgcgcacatacatccgccgccgcaactacgccaatacattccgttcatccgagattaca
gcccactatacactgacaaaaggtaagttcgaaggaaccatacttcttggagcgagtcag
gaatacaataaatacgagaatgagtcattcctcaaatatgacctaatcgacgactcaatg
accgcaatagacggcggcacaaccaacggcaatatctccggaaattataccgaatgggcc
atgcgctcatacttcggccgcatcaacctgtcgtgggacgacaaatacatgcttgaagcg
aatctgcgcgccgacggttcatcaaagtttgcaccgggacaccgctggggatatttcccc
tcggtatcggcaggatggcgcatctctgaagaatcattcatgaaggcgacacgctcatgg
ctcgacaatctgaagctgagagcttcctacggctcgctcggcaacaacgccaccacaagc
tactacatgtatcagtcgctgtttgcctcggccaactacatcctcaacggcagtatcaca
ggtggcttcgcccagtctatcctgtcaaatcagaatctttcatgggaaaaaacctacatg
accaacttcggtatcgacttcggattgttcaacaaccgtctgaacggctcattcgacata
tacgacaagaataccaaagggatacttatctcactcccggctcccctggagcatggcaca
agcaccgtacccaaccagaatgccggcgaagtaaacaaccgcggacttgagtttgacata
aactggagcgaccgaataggcaacgtaggctactccgttggattcaacatggcatacgta
agaaataaggtcactaaattccagggcgacgtgccctcaatcagcggtgtatacaagacc
caggagggacgccctatcaaccagctctacgtcataaaagtcgaccgcatcgtgcgcgac
caggccgatctcgactatgtgcagtcgcttgtcgaccgcaatcccgactatttcgccaca
ttccagcgtcctgaactcggcgacttcctctatgccgacaccaacggcgacggctccctc
gacaacaacgacagagtggagataggcaaaggaaccctcccgacattcacctacggcgca
agcctcggtctcacatggaaagactttgatttcagcctcctgctccagggcgtaggcaac
catcaggtatattacaacaaccaggcattccgcttcgtgacagttatgggacagtcgctt
ataaaggacataaccgacaacgcatggactctggagaatccctacaattcaaaatatcct
atactacgcaacaactccaacgccaagaataatatcgccagcgacgcctttgtacacaac
gctgcatacctgcgctgcaagaatatccagctcggctacaccgtgccacgcaatattaca
aagaaagtatacatctccaatctgaaaatctacgcaagcatcgacaatctgtttacaatc
acaaaattcccgggtcttgacccggaagtaggagccgacgtaggctaccccgccgtacgc
cagtattctctcggcatcaatctgacattctaa

DBGET integrated database retrieval system