KEGG   Muribaculum intestinale: A4V02_02165Help
Entry
A4V02_02165       CDS       T04438                                 

Definition
(GenBank) alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
pary  Muribaculum intestinale
Pathway
pary00500  Starch and sucrose metabolism
pary01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pary00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A4V02_02165
Enzymes [BR:pary01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     A4V02_02165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1 DASH_Spc34 Spc7 RPW8 SlyX GAGA_bind TMCO5
Motif
Other DBs
NCBI-ProteinID: ANU62648
UniProt: A0A1B1S783
LinkDB All DBs
Position
complement(558397..559899)
Genome map
AA seq 500 aa AA seqDB search
MKAICFYFQIHQPFRLKRYRFFDIGNDHYYDDEFTNEDILSRIAHRSYIPAAESLLRMIE
ESKGKFRCAISLTGVVIEQLEIYVPEFLDLLKKLADTGCVEFLAETYSHSLASLIDPEEF
EAQVKAHDQLIYEKFGQHPKVLRNTELIYCDEMAPMIHSMGYKGVITEGAKHILGWKSPN
YVYQAASCPKLKLLLKNDKLSDDIARNFSNTSWEAYPLTADKYIDWIASTPADEQVVNLF
MNLETFGDFQPRETGIFQFLEALPRFAAERGVEFITPSDAISKLKPVAELSVLHPISWAD
EAHDTSAWLGNKLQNEAFNKLYSVAERVRLCTDRRLKQDWNHLQSSDHFFYMSTKHFNDG
AAHAMFSPYETPYQAFTNYMNVLADFLVRVDEQYPKSIDNEELNALLSTINNQNSEIEML
NKELQSMRNNLEHLNEEHATRAAVAQGKKLDENLQVEEAPAKKATVKKGCKKNVEKAPKA
EKKPRASKKAKNDAADEPKA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctatctgcttctatttccagatccatcagcccttccgtctaaaacgctaccgc
ttcttcgatatcggcaacgaccactactacgacgacgagtttaccaacgaggatatcctc
tcgcgtatagcccaccgcagctacatccccgccgccgaatcgttgctgcgcatgattgag
gagagcaagggcaaattccgctgcgccatatcactcacaggcgtggtaatcgagcaactc
gaaatctacgtgcccgagttcctcgacctgcttaagaaactggccgacaccggatgtgtc
gaattccttgccgaaacatattcccactctctggcttcgctcatcgaccctgaagagttt
gaggcacaggtaaaagcccatgaccagctcatatacgagaaatttggacagcacccaaag
gtcctgcgcaataccgagcttatctactgcgacgagatggccccgatgattcactcgatg
ggatacaaaggcgtaatcaccgaaggcgcaaagcatatcctcggatggaaatcgcccaac
tacgtatatcaggccgcatcatgcccgaagctcaagctgctgcttaagaacgacaaactg
tcggatgacatcgcccgcaacttctccaacacatcatgggaggcatacccgcttacagcc
gacaaatatatcgactggattgcatcgacccccgccgacgagcaggtagtaaacctcttc
atgaatctggagacattcggcgacttccaaccgcgcgaaaccggcatattccagttcctt
gaagctctgccccgatttgctgccgaacgcggcgtggaattcatcactccatcagacgct
atcagcaagctcaaaccggtagccgaactgagcgtactccaccccatctcatgggccgac
gaagcacacgacacctcggcatggctcggcaacaagctccagaatgaggcattcaacaag
ctctactcagtggccgaacgcgtacgcctctgtaccgaccgccgactcaagcaggactgg
aaccatctgcagtcgtccgaccacttcttctacatgtcgaccaagcacttcaacgacgga
gccgcccatgcgatgttctcgccctacgagacaccctatcaggcattcaccaattatatg
aatgtactggccgacttcctcgtgcgcgtcgacgagcaatatcccaagtcgatcgacaat
gaagagctcaacgccctgctctcaaccatcaacaaccagaactcggaaatcgagatgctc
aacaaagagctccagtcgatgcgcaacaacctcgagcacctcaacgaggagcacgccaca
cgtgctgctgtagcccagggtaagaaacttgacgaaaatctccaggtagaggaagctccc
gccaagaaagcaaccgtcaagaaaggatgcaaaaaaaacgtcgaaaaagcaccgaaagcc
gaaaagaaaccccgcgcttccaaaaaggctaaaaacgacgcagccgacgagcccaaagcc
taa

DBGET integrated database retrieval system