KEGG   Muribaculum intestinale: A4V02_02575
Entry
A4V02_02575       CDS       T04438                                 

Definition
(GenBank) galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Organism
pary  Muribaculum intestinale
Pathway
pary00052  Galactose metabolism
pary00520  Amino sugar and nucleotide sugar metabolism
pary01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pary00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A4V02_02575
   00520 Amino sugar and nucleotide sugar metabolism
    A4V02_02575
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pary04147]
    A4V02_02575
Enzymes [BR:pary01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     A4V02_02575
Exosome [BR:pary04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A4V02_02575
SSDB
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_N GHMP_kinases_C MccV
Other DBs
NCBI-ProteinID: ANU64718
UniProt: A0A1B1SD12
LinkDB
Position
666537..667670
AA seq 377 aa
MKENIRKVFADRFGTAGTLYASAGRINLIGEHTDYNGGFVFPGAIDKVIMAEMKANGTDK
VRVFSIDINEYAEFGLNEEDAPKQQWARYIFGVCREIIKRGGVVNGFDAVFAGNVPLGAG
LSSSAALESCFAFALNDMFNDNKIDKFELAKIGQSTEHNYCGVNCGIMDQFASVFGKKDH
LMRLDCRSLEYEYFPFKLDGYKLVLVDSKVKHELVDSPYNKRRASCENVARTLGVETLRD
AEMADLEKIKDRISEEDYNRAVYVIGEKQRVLDVCDALQKGDYDTVGDRMYKTHEGMSKL
YEVSCEELDYLNDIAKECGVTGSRIMGGGFGGCTINLVKDDLYDSFIATAKEKFNARYGH
EPVVYDVIVSDGARRVE
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgaaagagaacatccgcaaagtgtttgcggatcgcttcggcactgccggcacactttac
gcatcggccggacgtatcaaccttatcggcgaacataccgactacaacggcggcttcgta
ttccccggcgcgatagataaagtaattatggccgagatgaaggccaacggtaccgacaag
gtacgtgtattctccatcgacatcaacgagtatgccgagtttggcctcaacgaggaggac
gcacccaagcagcagtgggcccgctatatattcggtgtatgccgcgagataatcaagcgt
ggcggtgttgtcaacggttttgatgccgttttcgccggaaatgtacccctgggtgccgga
ctttcgtcgtcggcagctctcgaaagctgttttgcattcgctctcaacgatatgttcaac
gacaataagattgacaagtttgagcttgccaaaatcggccagtcgaccgaacataactat
tgcggcgtgaactgcggcataatggaccagtttgcttcagtgttcggcaagaaggaccat
ctcatgcgtctcgactgccgctcgctcgagtatgagtattttcccttcaaactcgacggc
tacaagctcgtgcttgtcgactcgaaggtgaagcatgaactcgtcgactctccctacaac
aaacgtcgcgcctcatgcgagaacgtggcccgtacactcggcgtagagacactgcgcgac
gcagagatggccgaccttgagaaaatcaaggaccggataagcgaggaggactacaaccgt
gcggtatacgttatcggtgagaagcagcgtgtgctcgatgtgtgcgatgctctccagaag
ggtgactatgacactgtaggcgaccgcatgtacaagacccacgaaggcatgtcgaaactt
tacgaggtgagctgcgaggagcttgactacctcaatgacatagccaaggagtgtggcgtc
accggctcgcgcatcatgggtggcggcttcggcggctgcaccatcaacctggtgaaggac
gacctctacgactcgtttatcgccactgccaaagagaaattcaatgccaggtacggtcac
gagcccgtggtgtacgatgtaatcgtaagcgacggcgcccgtagagtcgaataa

DBGET integrated database retrieval system