KEGG   Muribaculum intestinale: A4V02_06630Help
Entry
A4V02_06630       CDS       T04438                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pary  Muribaculum intestinale
Brite
KEGG Orthology (KO) [BR:pary00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A4V02_06630
Enzymes [BR:pary01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A4V02_06630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like Thioredoxin_3 Thi4 DAO NAD_binding_8 FAD_oxidored K_oxygenase FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ANU63427
UniProt: A0A1B1S9F7
LinkDB All DBs
Position
1569434..1570993
Genome map
AA seq 519 aa AA seqDB search
MLDKDIIEQLKSIFGNLKSDIVFLLQQSDNAAQSSEMKSFLDDVASTSPHLSVVESNDKA
EAPTFEIVKNGQPTGVKFCGIPNGHEFTTLLLAILNSDGQGKNLPDETLASRIKVLKGPI
DLQTFVSLTCTNCPDVAQALNIIAILNPSVQNTVIDGAVVPELVQPLNIQSVPSVYADGK
PFSVGRSSLGDLLEKLESVYGFSDNTALQPVTREYDVIILGGGPAGAAAAVYCARKGFNT
AVIAKSVGGQVRETMDIENLISVPKTTGPQLAADLKTHLSQYAIDIFEDRNVDSADVTGS
EKTLVCGNETFKGKALIIATGAGWRKLSIPGESEHIGHGVAFCTHCDGPFYAGKRVAVIG
GGNSGIEAAIDLAAMCPHVDVFEFLDTLKADGVLQSKSADMNNIDIHVSSQVTEIIGDGK
NVSGIKVKDRVSGAETVYPVSGVFVQIGLVPNSSLFKDSIAITRSGEIIVDERCRTSVNG
VYAAGDVTTVPYKQIVVAMGEGAKAALSVFEDSMRGMLG
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacaaagatattatcgaacaactgaaatcgatatttggaaatctgaaatcagat
atcgttttcctactacagcaatcagacaatgcggctcagtcatcagagatgaaatcattt
cttgacgatgtagcctctacatccccgcatctctccgttgttgagtcaaacgacaaagcc
gaagcgccaacatttgagattgtaaaaaacggacaaccgacaggcgtgaagttctgtgga
attccgaatggccacgaattcaccacactgttgcttgcgatactgaattccgacggtcag
ggcaaaaacctcccggatgagacacttgcctcccgtattaaagttctgaaaggcccgatt
gacttacagacatttgtctccctcacgtgcaccaactgtccggatgtagcccaagcattg
aatatcattgccatactgaatccaagcgttcagaatacagtaatagacggagctgtagta
ccggaactcgtacagccacttaacatccagtcagtaccaagtgtatacgccgacggcaag
ccattcagcgtaggacgctcttcgcttggagacctgcttgaaaagctcgaatctgtatac
ggtttctccgacaacaccgcattgcaacctgttacacgtgaatatgatgtaatcatactt
ggaggaggtccggccggcgctgcggcggcagtctattgtgcaaggaaaggattcaatacc
gcagtaatcgccaaaagcgttggcggacaggtacgcgagaccatggatatcgagaacctc
atctcagttccgaagacaaccggcccacagcttgccgccgacctcaagactcatctctcg
caatacgccattgatatatttgaagaccgcaatgtcgactcggctgacgtgaccgggagc
gagaagactcttgtttgcggaaatgagactttcaaagggaaagccttgattatcgccaca
ggagcaggatggagaaaattgtcaatccccggcgaatcggaacatatcggacacggggtg
gcattctgtacccactgcgacggtccattctatgcaggcaagcgtgtggctgttatcgga
ggtggcaactccggcatagaagccgccatagatcttgccgcgatgtgtccgcatgtagat
gtattcgagtttcttgacacattgaaagccgacggagtactccagagcaagtctgccgat
atgaacaatattgatatccatgtatcatcacaagtgaccgaaataatcggtgatggaaag
aacgtatccggaataaaagtcaaagacagagtatccggtgcagagacagtatatccggtg
tcgggagtattcgttcagatcgggctcgtgccaaacagctctctgtttaaagacagtatt
gcaattaccagatccggcgaaatcatcgtggatgagcggtgcaggacttctgtcaatggc
gtctatgccgcaggagatgttacaaccgtgccatacaaacagattgttgtcgccatgggc
gaaggcgccaaagccgcgctatctgtattcgaagactccatgcgcggtatgcttggataa

DBGET integrated database retrieval system