KEGG   Muribaculum intestinale: A4V02_06995Help
Entry
A4V02_06995       CDS       T04438                                 

Definition
(GenBank) hypothetical protein
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pary  Muribaculum intestinale
Pathway
pary00473  D-Alanine metabolism
pary01100  Metabolic pathways
pary01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pary00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A4V02_06995
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A4V02_06995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pary01011]
    A4V02_06995
Enzymes [BR:pary01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A4V02_06995
Peptidoglycan biosynthesis and degradation proteins [BR:pary01011]
 Precursor biosynthesis
  Racemase
   A4V02_06995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase
Motif
Other DBs
NCBI-ProteinID: ANU63496
UniProt: A0A1B1S9M5
LinkDB All DBs
Position
1646377..1648869
Genome map
AA seq 830 aa AA seqDB search
MQYSALRIADILNVATPIYPDALIDVLLTDSRSLTYPERTLFFALTTPSGDGHRYVAELY
RRGVRNFVVRRRPDTADACYTDANFFVVPDVRAALQQLARIHRGKFPSLPVIGITGSRGK
TTLKEWLHHLLSSSIHTVRSPRSYNSQIGVPLSLWEITPDAELGIFEAGISEKGEMDALR
DMIAPTIGVITNVGIEHADGFASRSDKCDEKIKLFSACQKVVYSVDDPLLAQRAACAIQP
ERSITVSRLGDNNADIKIHCTINRAESCADIHFDAHHFHLNGNIKIPFTSEAALDNASLA
IGTLIAMGMNPSELSERFTSIPNIDTRLNVIEGVNNCILITDHYAADYPSLMSALDFMNR
RRTSGQHTTVILPDMETVGTDDVEHMYKNISLLLVKYGIDRIIGIGEEITRHACIFPSGN
SRFYTSVADFMAAETPTDFGHSLILVKGAENHNTEQITEMLEARQHETVLEVDLDAMVHN
FNIFRAQLKPSTGIVAMVKASGYGAGSYELAKTLQNQGAAYLAVAVADEAMDLRNSGITM
PIMVLNPKVTNYHTLFSHMLEPEVYSFDLLHEIIEEGRRYGVKDFPIHIKLDTGMHRLGF
IESDIDQLISELKSQDIVTPRSVFSHLAAADCPDMDDYTMEQFTMFERCSSRMKDAFPGM
LRHILNSTGITRFPQYQYDMVRLGICLYGIPTLSDGSQNDLQPVSSLYTVVISIKNWSAG
TTVGYGRKGVLTRDSRIATIPIGYADGLRRALGCGHSSVWVNGSLCPIIGNICMDICMVD
VTDARCEVGDRVEIFGHNINVADIADKLGTIPYEVLSSVSSRVKRIYFRE
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgcaatattccgcactccggatagccgacatattgaatgtggcgactcctatatatccc
gatgctctaatcgacgtactacttactgattctcgctccctgacatatccggagcgtacg
ctattctttgcacttactaccccgtcgggcgacggccaccggtatgtggctgaactatac
cgccgtggtgtacgtaatttcgttgtacgccgccgcccggacacagccgatgcatgctat
acagatgccaacttctttgtggtaccggatgtacgcgcagcattacagcagctcgcacgc
atccatcgcggaaagttcccttcactgccggtcataggcataacaggcagcagaggcaag
acaacattgaaagaatggctccaccacctgctttcttcctcgattcataccgtgcgctct
ccgcgttcctataacagtcagattggagtcccactttctctatgggaaatcactcccgat
gcggagctcggcattttcgaagccggcatttccgaaaaaggtgaaatggacgctctgcgc
gacatgattgcacccacaatcggcgtaatcacgaatgtcggcatcgagcatgccgatggc
ttcgcatcgcgcagcgacaagtgcgatgaaaaaatcaaactattctcagcatgccagaaa
gtcgtatattctgtcgatgatccactgctcgcccaaagagcagcatgcgcgattcagccc
gagcgcagcatcaccgtgagccggcttggcgacaacaatgccgacataaaaattcattgc
acaatcaacagggcggaatcctgtgccgacattcatttcgacgcgcatcattttcatctg
aacggaaacatcaaaattccgtttacctccgaagctgctctcgacaatgcctctctggca
ataggcactctcatagcaatgggcatgaatccgtcggaactaagcgaacgattcacatca
atacctaatattgacacacgcctgaatgtcatcgaaggggtaaacaactgcatcctcata
accgaccattatgcagccgactacccgtcactaatgtctgcgctcgacttcatgaacaga
cggcgcacatctggacaacacaccacggtgatactgcctgacatggagacggtcggcacg
gatgacgtagagcacatgtataagaatatctcactactgcttgtaaaatacggtattgac
cggattatcggaatcggagaggagataacacgccacgcctgcatatttccttcaggaaac
tcacgattctatacaagcgtggccgattttatggccgccgaaacgcctaccgatttcggc
cattcactcatacttgtcaagggtgctgaaaatcacaacaccgagcaaataaccgaaatg
ctcgaagcccggcagcacgagactgttcttgaagtcgacctggatgccatggtacataac
ttcaatattttcagagcacaactgaagccctcgacaggaattgttgccatggtaaaagca
tcgggatacggtgccggaagctatgaactcgccaagactctccaaaaccagggcgcggca
tatcttgccgtggctgtcgccgatgaagccatggatttgcgtaattccggcataacgatg
ccgataatggtactgaaccctaaagttactaattaccacacattgttcagccacatgctt
gaaccggaagtctactcattcgacctcctgcatgaaatcatcgaagagggacgccggtac
ggtgtcaaagatttcccgatacatataaaactcgacacaggcatgcatcgcctcggattc
attgaatctgacatagatcagctcatatcggaattaaagtcacaggacattgtcacaccg
cgctcagtattctcccatctggctgcagccgactgccccgacatggacgactacacaatg
gagcagtttactatgtttgagcgttgcagctcgcgcatgaaagatgcgtttcccggcatg
ttgcgccatatccttaactccacaggcataacacgctttccacagtatcaatacgacatg
gtacgccttgggatatgcctctacggaattcccaccctcagcgacgggagccagaacgac
ctgcaaccggtaagttcgctatacacagtagtgatatcaatcaagaactggagcgccgga
actactgtgggctatggccgaaaaggagtgcttacacgcgattcccgtatagccaccata
ccaatcggatatgccgacggacttcgccgggctcttggatgcggacattcatccgtatgg
gtcaacggctcgctatgtccgattataggcaacatctgtatggacatatgcatggtcgac
gtcaccgatgcgcggtgtgaagtaggcgaccgagtcgagatattcggccataatataaac
gtagcggatatcgccgacaaactgggcactatcccttatgaggtgctgagttccgtatca
tcacgcgtaaagagaatttacttccgcgaataa

DBGET integrated database retrieval system