KEGG   Muribaculum intestinale: A4V02_07455Help
Entry
A4V02_07455       CDS       T04438                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
pary  Muribaculum intestinale
Pathway
pary00500  Starch and sucrose metabolism
pary01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pary00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A4V02_07455
Enzymes [BR:pary01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     A4V02_07455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: ANU63577
UniProt: A0A1B1S9V3
LinkDB All DBs
Position
complement(1754525..1756636)
Genome map
AA seq 703 aa AA seqDB search
MKKHFAWLTAAGILTACSQGGPLQVSSPDGKLLVNFNIEEGGAPAYSASFDGEEIVATSY
LGFQMEKFGALTSGFKMTAHHESEHNETWAPVWGEQDSVVNHYRQLVVEMKKKTDSVDVL
LNVEFRVFDEGFAFRYVFPEQKTKQFVIDQELSRFAMTGDHTAWWIPGDYDTQEYEYTRS
QLSEIAARHTAALVGNVSASAFDQWAVQTSLMMKTGDEKPLYLNIHEAALIDYPAMHLLY
NDSSCTFTSALTPDGNGHMAVIDTPFSTPWRVVMVSDKATDILSTQIIYNLNESCVLDDT
SWIHPTKYMGVWWEMITGKSDWSYTNAHDFDLATFDYSKARPHGRHGATTDNVKRYIDFA
AANGFDQLLVEGWNVGWEDWLGREKDYVFDFVTPYPDFDIKALNDYAHSKGIKLMMHHET
SGSIPNYERHMEAAYSLMNEYGYDAVKSGYVGNILPKGSYHYGQPQIRHYLDAIRRAADH
KIMVNAHEAVRPTGLARTYPNLVGNESAMGTEYRNMTPGHVTILPFTRLKGGPMDFTPGI
FEMDLGKFSPDKTHKRATVAGQLALYVTMYSPLQMAADLPEHYAEKMDAFQFIKDVPVDW
SKSHYLDAEPGEFIVAARRAKGGDDWYVGGVTNDEARDVTVSMSFLKPGVTYQATFYTDA
PDADCDSNSGAYEISKETVTSRTVSTIHMARGGGFAISIVPVK
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacattttgcatggctgacggcagccggtatccttacggcatgctcgcagggt
ggaccgctacaggtgagttcgcccgatggaaaacttcttgtaaacttcaatatcgaggag
ggtggggcgcccgcttacagcgcttcgtttgacggggaggagattgtggccacctcttat
ctgggatttcagatggagaaattcggggcacttacctccggattcaagatgaccgcacat
catgagtcggaacataacgagacctgggcgccggtgtggggcgagcaggattcggtggtc
aaccactaccgtcagcttgtggtggagatgaagaaaaagaccgacagtgtcgatgtgctt
ctcaatgtggagttccgtgtgtttgacgagggctttgctttccgctacgtatttcccgag
cagaagaccaagcagtttgtcattgaccaggagcttagccggtttgccatgaccggcgac
catacagcctggtggataccaggcgactacgacacgcaggagtatgagtacacacgctcg
cagctgagtgaaatcgccgcgcgccataccgcagctcttgtgggcaatgtgtcggcctcg
gcatttgaccagtgggccgtgcagacgtcgctcatgatgaagaccggggacgaaaagccg
ctgtatctcaacatacacgaggctgcgctcatcgactatcctgcgatgcatctgctttac
aatgactccagctgcacgtttacctcggcccttactcccgacggcaacgggcatatggcg
gtaatcgacactccgttctctaccccatggcgtgtggtgatggtcagcgacaaggctacc
gacatactgtcgacacagattatatacaatctcaacgagtcgtgtgtgctcgacgacaca
tcatggattcaccctacaaaatacatgggtgtatggtgggaaatgattaccggcaaaagc
gactggagctacaccaatgcccacgacttcgacctcgccacgtttgattactcaaaggcc
cgtccccacggacgccatggcgccactaccgacaacgtaaagcgctatatcgattttgca
gcggccaacggattcgaccagttgctcgtggagggctggaatgttggctgggaggactgg
ctcgggcgcgagaaagattatgtgtttgacttcgtgacaccatatcccgacttcgatatc
aaggcgctcaacgactatgcccattccaagggtatcaagctgatgatgcatcatgagact
tccggctctatacccaactatgagcgtcatatggaggctgcctacagtcttatgaacgag
tatggttacgacgcggtgaagagcggctatgtgggcaatatcctgcccaagggttcgtac
cattacggacagcctcagatacgccattatctcgacgccatcaggcgtgccgccgaccac
aagataatggtcaacgctcatgaggctgtgcgtccgaccggtcttgcgcgcacttatccc
aaccttgtaggcaacgagagtgctatgggcaccgagtaccgcaacatgactccgggccat
gtcactatcctgccgtttacacgtttgaagggaggtccgatggatttcactcccggtatt
tttgagatggacctcggtaagttctcccccgacaagacccacaagcgtgcaacggtggcc
ggtcagctcgctctctatgtgaccatgtactcgcctctccagatggccgccgacctgccc
gagcactatgccgagaagatggatgcattccagtttataaaggatgtgcctgtcgattgg
agcaagagccattatcttgatgcggagccgggcgagtttatcgtggccgcacgccgtgcc
aagggcggcgatgactggtatgttggaggtgtcaccaacgatgaggcacgcgacgtcacc
gtgtcgatgtcgttcctgaagccgggtgtcacttatcaggctacattctataccgatgct
cccgatgctgactgcgacagcaactcgggcgcctacgaaatcagcaaggagactgtgaca
tcgcgtacggtatcgacaatccatatggcacgcgggggcggtttcgcaatatctattgtg
cctgtgaaataa

DBGET integrated database retrieval system