KEGG   Muribaculum intestinale: A4V02_12550Help
Entry
A4V02_12550       CDS       T04438                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
pary  Muribaculum intestinale
Pathway
pary00040  Pentose and glucuronate interconversions
pary00051  Fructose and mannose metabolism
pary01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pary00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A4V02_12550
   00051 Fructose and mannose metabolism
    A4V02_12550
Enzymes [BR:pary01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     A4V02_12550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N Pyr_redox_2 TrkA_N Shikimate_DH NAD_binding_3 ThiF
Motif
Other DBs
NCBI-ProteinID: ANU64467
UniProt: A0A1B1SCF2
LinkDB All DBs
Position
complement(3033482..3034531)
Genome map
AA seq 349 aa AA seqDB search
MKENMNVAVMNGIGKMGFITRPVPTPSKGEVLIKIDYVGICGSDIHYYETGRIGNYVVEP
PFVLGHEAAGEVVALGEGVTNLSVGDRVALEPGKTCGHCRYCREGKYNLCPDVVFFATPP
VDGVFQEYATHPADLCFRLPENVSNLEGALIEPLAIGFHAANQGGARAGQKAVVFGAGCI
GLVCMMALKAEGVSEIIVVDVMAKRLEKAMTLGATATINAAEEDTVERIKELTGGEGIDL
SIETAGTEITTRQAIEVARKGSTIVLVGYSKTGELTLPISLFIDKELTFRSVFRYRHIYP
MAIEAVAKGRVNLKDIATHIFGLSEIQEAMDRSVSDKANIVKAAVRIDQ
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaacatgaatgtagccgtaatgaacggcatcggaaagatgggctttatcaca
cgcccggttccaactccgtcaaagggagaagtacttataaagattgactatgtaggcata
tgcggctctgatatacattattatgaaacaggccgcataggaaattatgtggtagagccc
ccgtttgtgctcggccacgaggcagcaggcgaggtagtggcgcttggcgagggagtgaca
aatctctccgtaggcgaccgtgtggcgcttgaacccggcaagacatgcggtcactgccgc
tactgccgtgaagggaaatacaatctgtgtcccgacgtggtgttcttcgccactccgcct
gtcgacggagtattccaggaatatgccacccaccccgccgacctctgcttccggcttccg
gaaaatgtaagtaatctcgagggtgcgcttatagagcctctggccatcggattccatgcc
gccaaccaaggtggcgcacgggccggacagaaagccgtggtattcggagccggatgtatc
ggactggtatgcatgatggcgctgaaagccgagggagtgtcggaaattatcgtagtcgat
gtcatggccaagcgtcttgagaaagcgatgacactcggagcgaccgccaccatcaatgca
gccgaagaggatactgtagagcgtataaaggaactcaccggcggcgaaggcatcgacctg
tcgattgagaccgcaggcaccgagataaccacccgccaggctatcgaggtggcccgcaaa
ggctccactatagtgcttgttggctacagcaagaccggcgaactcacattgcccatatct
ctgttcatcgacaaggagctcacattcagaagtgtattccgctaccggcatatctatccc
atggcaatcgaggctgtagccaaaggacgtgtgaacctgaaagatatagcaacccacata
ttcggcctcagcgagatacaggaagccatggaccgcagcgtaagcgacaaagccaacatc
gtgaaggctgccgtaaggattgaccagtaa

DBGET integrated database retrieval system