KEGG   Pyrobaculum arsenaticum: Pars_0772Help
Entry
Pars_0772         CDS       T00503                                 

Definition
(GenBank) ERCC4 domain protein
  KO
K10848  DNA excision repair protein ERCC-4 [EC:3.1.-.-]
Organism
pas  Pyrobaculum arsenaticum
Pathway
pas03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pas00001]
 Genetic Information Processing
  Replication and repair
   03420 Nucleotide excision repair
    Pars_0772
Enzymes [BR:pas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Pars_0772
DNA replication proteins [BR:pas03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     Pars_0772
DNA repair and recombination proteins [BR:pas03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     Pars_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ERCC4 HHH_5 HHH RE_ApaLI IMS_HHH 5_3_exonuc OspE
Motif
Other DBs
NCBI-ProteinID: ABP50358
UniProt: A4WIZ1
LinkDB All DBs
Position
complement(689013..689663)
Genome map
AA seq 216 aa AA seqDB search
MEFIVLVDTREHAQEVVRHIKEAGCRVLKTKLEAGDYVAGEYVFERKSVDDFVNSVIEGR
VFEQAERLKSSGLKPVVVVEGDLWRELRYRRISPNAVLGALLALSSMGVGLVYTEDKAQT
GVLVCLAARRAKKAAKAPAPKKKEADVRSLQIALLASLPGIGPRRAEELLKKYGTPLNAL
LNYKSWEVDSKSHTLIKRVLETPFDASNTLDDYLGP
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtggaattcatcgtccttgtagacactagggagcacgcccaggaggtagttaggcacatc
aaggaggcagggtgcagggtcctcaagactaagctggaggccggcgactacgtagccggc
gagtacgtctttgagcggaagagcgtagacgacttcgtcaactcggtgatagaggggagg
gtcttcgagcaggccgagaggctcaagtcctccgggctgaagcccgtcgtcgtggtggag
ggcgacctctggagggagcttagatataggagaatttcgccaaacgccgtgctcggggcg
ttgctcgccctaagctccatgggcgtcgggctggtctacacagaggacaaagcccagaca
ggcgtgctggtctgcctcgcggcgaggcgggcgaagaaggcggcgaaggcccccgccccg
aagaagaaggaggccgacgtgaggagcctccagatagccctcctagcctccctccccggc
attgggccgaggcgcgccgaggagttgttgaagaagtacggcacgccgctaaacgcgttg
ctcaactacaagtcgtgggaggtagatagcaaaagccacaccttaataaagagggtgttg
gaaacccccttcgacgccagcaacacgctagacgactacctaggcccctaa

DBGET integrated database retrieval system