KEGG   Pseudoalteromonas atlantica: Patl_0606Help
Entry
Patl_0606         CDS       T00372                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00620  Pyruvate metabolism
pat00680  Methane metabolism
pat01100  Metabolic pathways
pat01120  Microbial metabolism in diverse environments
pat01200  Carbon metabolism
Module
pat_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Patl_0606
  09102 Energy metabolism
   00680 Methane metabolism
    Patl_0606
Enzymes [BR:pat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Patl_0606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABG39135
UniProt: Q15YA3
LinkDB All DBs
Position
complement(698816..701434)
Genome map
AA seq 872 aa AA seqDB search
MPKILDSQLKETVRNLGSTLGDMIRAQLGDEWLQRIETIRLDGRESYKGDSECSDKLKAL
FSELEDEQLLVVGRAFSQFLNLANIAEQEFNSANHDQDSIQELFNHLDKDNVSAETFEKA
VNQLSIELVLTAHPTEVTRRTLIHKHSELAQCLRQIHQTSLSDIERDKIRTRIADLVAQA
WHTEEIRTVRPTPVDEARWGFSVIENSLWEAVPDFVRELSAKFEAKYNLALPLDAAPVKL
SSWMGGDRDGNPFVTSKVTQQVLLLARKRAAKLFAQDVDMLQVELSMSDCDDTIRSMVGD
ELEPYRALLRPLLDTLTNTKNGIAEFLSGASVDDSKWIASKDELLTPLMLCYNSLQACGM
SVIADGRLLDTIRRVHCFGVHLLKLDIRQDSERHADVFSELTRHLGMGDYGNWSEEDKQA
FLLKELSSKRPLFPAKWQPSADVQEVIDTCKVVAQHSEEGFGIYIISMASLPSDVLSVHL
LLREFGVTWPMPVAPLFETLDDLNAAATVIDALMNIDWYRGYIQGHQYVMIGYSDSAKDA
GAMAAGWAQYESQEALVGIAEKYGVELTLFHGRGGTIGRGGLPAHAAILSQPPGSLSGGF
RVTEQGETIRYKFGMPQLAQRSLALYASAILEALISPPPAPKQEWRDLITEVAANARDNY
RNTVRHDENFVPYFRVATPEQELGKLPLGSRPAKRKPSGGIESLRAIPWIFAWAQTRLVL
PSWLGAMKAVQTAIDAGHRPLIDDMLQNWPFFHSRFSMLDMVFGKADPRISAEYDKRLVP
EELRHLGDALRDELNMSMSLLLDVLQQKEVMESDPKGNESMNIRAGYLQPLHFLQIELLE
RIRAKGEEADPTLERAMMVTIAGIAVGMRNTG
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
gtgccaaaaattctagactcacaactcaaagaaaccgtacgtaatctaggttcaacgtta
ggtgacatgatccgagcccaattgggggatgagtggctgcaacgaatagaaaccatcaga
ctagatggtcgcgaatcatataaaggcgacagtgaatgttctgacaaacttaaagcacta
tttagtgagctcgaagatgagcagctgttagtcgtaggtcgtgcattttctcaatttcta
aatttagcgaatatcgccgagcaagaatttaacagcgccaaccatgatcaagactctatt
caagaattgttcaatcatttggacaaagataacgtatctgcagagaccttcgaaaaagcg
gtaaaccaactcagtattgaattggtattaacggcacatcctactgaggtcactcgtcgc
acattgatccacaaacacagcgaattagcacaatgtttgcgtcaaatacatcaaacgagc
ttatctgacattgaacgagataaaattcgcaccagaatagcggatttggtggcacaagca
tggcacacagaagaaattcgcaccgtacgccctacccctgtagatgaagctcgttggggt
ttttcggttatcgaaaactcgttgtgggaagcagtacccgatttcgtacgtgagctaagc
gcaaaatttgaagcgaaatacaatcttgcgctccccctagatgcagccccagtgaaatta
agctcgtggatgggcggtgaccgagacggtaacccattcgtaacatcgaaggtgactcag
caagttctgttactcgcccgtaaacgcgcagcgaaactgttcgctcaagacgtggatatg
ttacaagtagagctgtcgatgagtgattgtgacgacacaattcgttcaatggtaggcgat
gaacttgaaccgtatcgtgcactattacgtcctttgctggacacgctaaccaataccaaa
aatggtattgctgaatttctaagcggtgcgtcagtagacgacagtaaatggattgccagc
aaggatgagctgctgactccgctaatgctatgttacaactcgttgcaagcttgcggcatg
agcgtcattgccgatgggcgcttgttagacaccattcgccgagtacattgttttggagtg
catctacttaagttggatattcgccaagattctgagcgtcacgcagacgtattcagtgag
cttacccgccacttgggcatgggcgactacggcaattggagcgaagaagacaagcaagca
ttcttgttaaaagaattgagctcgaagcgacctttatttccagccaaatggcagccctct
gccgacgttcaagaagtgattgatacttgtaaagtggtcgcacagcacagtgaagaaggc
ttcggtatttacattatatcaatggcgagtttaccttcagacgtgcttagcgtgcaccta
ttgttgcgcgaattcggcgtgacatggcctatgcctgttgccccattattcgaaacgctt
gacgatctgaatgctgctgccactgttattgatgccttaatgaacatcgactggtatcgt
ggttacattcaaggtcatcagtacgtaatgataggttattctgactcagcgaaagacgct
ggcgctatggctgcaggttgggctcagtacgagtcgcaagaagcccttgttgggattgct
gaaaagtacggcgttgaattaacgctgtttcatggtcgcggcggtacaattgggcgtggt
ggtttacccgctcatgcagcgatcctgtcccagcctccaggctctttatctggcggtttc
cgtgttaccgagcaaggtgaaaccattcgttataaatttggcatgccgcaacttgctcag
cgcagtttagctttgtacgccagcgcgatattagaagccctaatttcgccgccgccagcg
ccgaaacaagaatggcgtgatttaatcaccgaagtggctgcaaacgcacgcgacaactac
cgcaatacagtacgtcacgatgagaatttcgtgccttatttcagagtcgccacgccggaa
caagaactaggcaaattgccattgggtagccgcccagccaagcgtaaacctagcggcggg
atcgaaagcctacgtgctataccttggatattcgcatgggcgcaaacacgtttggtttta
ccgtcgtggttaggtgcaatgaaagcggttcaaaccgctattgacgcaggtcatcgccca
ctgatcgacgatatgcttcaaaactggccgttctttcactcgcgcttctccatgctagat
atggtgttcggtaaagccgacccacgtattagcgctgaatatgacaagcgtttggtccct
gaagaactgcggcatttaggtgatgccttgcgtgatgaactcaatatgagtatgagcttg
ttactcgatgtgcttcaacaaaaagaagtcatggagtcagacccgaaaggtaatgaatct
atgaacatccgtgcaggttacttacaaccattgcattttttacaaattgaattgctagag
cgtattcgtgcaaaaggtgaagaagcggacccaacgttagagcgcgccatgatggtgacc
atcgccggtattgcagtaggtatgaggaatacggggtag

DBGET integrated database retrieval system