KEGG   Pseudoalteromonas atlantica: Patl_1067Help
Entry
Patl_1067         CDS       T00372                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pat  Pseudoalteromonas atlantica
Brite
KEGG Orthology (KO) [BR:pat00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Patl_1067
Enzymes [BR:pat01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Patl_1067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like DAO FAD_binding_3 NAD_binding_7 NAD_binding_8 Thi4 AlaDh_PNT_C FMO-like Glutaredoxin K_oxygenase Thioredoxin_4 Spermine_synth
Motif
Other DBs
NCBI-ProteinID: ABG39593
UniProt: Q15WZ5
LinkDB All DBs
Position
1277044..1278651
Genome map
AA seq 535 aa AA seqDB search
MLDAKLKGQLATYLENLTSPVELRIAVDEQHQAKKSAELTDLANEIAALSPLVSVVAQSK
SDIRKPSMEVVSITNSTSITFAGVPMGHEFTSLILALLNSGGHPVKISEQQVAEIKSLSG
SYQFETYVSLSCQTCPGVVQALNVLSVINPNITNTMIDGSLFQEEVTQRNIMSVPSVYLN
GELFTQGAVTIEKILSKIDPQADAKQAQSLNDKAPYDMLIVGGGPAGAAAAIYAARKGIR
TGIVAEKFGGQVTDTMAIENFISVKATDGPKLVSGLEQHVKDYDVDIMTNNKAVKLTKDG
LLNIELENGALLSSKTVMLATGARWREMNVPGEQQYRGAGVAYCPHCDGPLFKGKRVAVI
GGGNSGIEAALDLANIVEHVTVLEFDSKLRADEVLQRKAKAANNIDIILNAMTTEVQGDG
KRVTGLAYQDRASQESHQVELAGIFVQIGLVPNTEWLKGDIALTARGEIEVGQRGETSIE
GVFAAGDVTTSPYKQIIIAMGDGANAALGAFDYLLRAPADENTPSVESNIGEKAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgcaaaattaaaaggccaattggcgacttatttagaaaatttaacttcaccc
gtggagttacgcattgctgttgatgagcaacatcaagctaagaaatccgcagaactcaca
gatttggcgaatgaaatagctgcgttatcgccgttggtcagcgttgtggcgcaaagtaaa
agcgacattcgaaaaccgtcgatggaagtggtttccataacaaatagcacctcaattact
tttgctggtgtacctatgggccatgaattcacttcattaatactcgcgttattaaacagt
ggcggccacccggtgaaaatcagcgagcagcaagtagctgaaataaagtcactttctggt
tcataccaatttgagacatacgtttcgttgagctgtcagacatgcccaggggtagtgcaa
gccttaaacgtgttgtctgttatcaatccaaatattactaataccatgattgatggttca
ctgtttcaagaagaagtgacacagcgcaatatcatgtcagtaccaagcgtgtatttaaat
ggcgagctgtttacccaaggggcagtgaccatagagaaaattttaagcaaaattgaccct
caggcagatgccaagcaagcccagtcactcaatgacaaagcaccttatgacatgctcatt
gtaggcggcggtccagcgggtgcagccgctgcgatttacgcagcaagaaaaggcattcgt
actggtattgtggccgaaaagtttggtgggcaagtgactgacaccatggctatcgaaaac
tttatttcggttaaagcgactgacggccctaaacttgtgtcaggccttgagcaacacgtg
aaagattatgatgtggacatcatgacgaataataaagccgtgaagttaacaaaagacggc
ttgctcaatatcgagcttgagaatggcgcattgttatccagtaaaacagtgatgttagcc
accggagcaagatggcgtgaaatgaacgtgccaggcgagcaacaataccgcggggcaggc
gttgcttattgcccacactgtgatgggccgctatttaaaggcaaacgcgtcgcggtgatt
ggtggcggtaattcaggtatcgaagcggctcttgatttagccaatatcgttgaacatgtc
accgtactcgaatttgatagcaagttgcgtgctgatgaagtacttcagcgcaaagcaaaa
gcggctaacaatatcgacattatcttaaatgctatgacgacagaagtgcaaggcgatggc
aaacgtgttaccggtctagcctatcaagaccgagccagccaagaaagtcatcaagtcgaa
ttggctggcatttttgtgcaaattggtttggtgccgaacaccgaatggttaaaaggtgat
attgccttaactgctcgaggtgaaatagaagtaggccaacgtggtgaaacctcgattgaa
ggtgtatttgccgcaggtgatgtaacgacttcgccttacaagcaaattatcatcgccatg
ggtgatggagcaaatgctgcactcggtgcgtttgattacttacttagagcgccggctgac
gaaaataccccgtcagttgaaagtaacatcggtgaaaaggcagcttga

DBGET integrated database retrieval system