KEGG   Pseudoalteromonas atlantica: Patl_1260Help
Entry
Patl_1260         CDS       T00372                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pat  Pseudoalteromonas atlantica
Pathway
pat00061  Fatty acid biosynthesis
pat00780  Biotin metabolism
pat01100  Metabolic pathways
pat01212  Fatty acid metabolism
Module
pat_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Patl_1260
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Patl_1260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pat01004]
    Patl_1260
Enzymes [BR:pat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Patl_1260
Lipid biosynthesis proteins [BR:pat01004]
 Fatty acid synthase
  Component type
   Patl_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas CvfB_WH PS-DH
Motif
Other DBs
NCBI-ProteinID: ABG39786
UniProt: Q15WF2
LinkDB All DBs
Position
1510265..1510711
Genome map
AA seq 148 aa AA seqDB search
MVNNINQLGIEEILELLPHRYPFLLLDRVTDYTLGESITAYKNITFNEPCFTGHFPGKPI
FPGVLILEALAQAAGVLGFKTAGNSDDLYLYAGIDKARFKHPVVPGDRLDMDVRLIKERR
GIWKFHGVGSVDGKAVCEAEFMCAMRKL
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
ttggttaataatatcaatcagcttggaattgaagaaattcttgagcttttaccccaccgt
tacccatttttattacttgatcgtgttacggactacaccttaggtgaatcgatcacagcc
tataagaacattacctttaatgagccgtgcttcactggccattttccgggtaagcctatt
ttccccggggtactcattttagaagcattagcacaagccgcaggcgtgttaggctttaaa
actgcaggtaatagtgacgatttatatttgtatgcagggatagataaagcgcgctttaaa
catcctgttgtgcctggtgatcgtttagatatggacgtgcgccttataaaagagcgccgc
gggatctggaaattccacggtgtcggcagcgtagatggcaaagccgtctgtgaagcagaa
ttcatgtgtgccatgcggaaactataa

DBGET integrated database retrieval system