KEGG   Pseudoalteromonas atlantica: Patl_2005
Entry
Patl_2005         CDS       T00372                                 

Definition
(GenBank) 23S rRNA m(2)G-2445 methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
pat  Pseudoalteromonas atlantica
Brite
KEGG Orthology (KO) [BR:pat00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pat03009]
    Patl_2005
Enzymes [BR:pat01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     Patl_2005
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     Patl_2005
Ribosome biogenesis [BR:pat03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Patl_2005
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM MTS Cons_hypoth95 Methyltransf_25 Methyltransf_31 THUMP Met_10 Methyltransf_11 TRM PrmA Methyltransf_3 Methyltransf_16 Methyltransf_23
Other DBs
NCBI-ProteinID: ABG40523
UniProt: Q15UB5
LinkDB
Position
2444192..2446297
AA seq 701 aa
MFEFLVTTSKGLDELLAQEITKLCPQLSVKTKPGQVLFTGEIEQAYKICLWSRLANRVML
KLADGHVDSADDVYQITSSVNWTSHFSVNSTFVVDFVGASHCINNSQFGALKIKDAVVDQ
FNELFESRPSVSKIEPDIRIQGRMWSDKLTVYLDLSGSSLHQRHYRTKTGLAPVKEHIAC
AMLVRSGWANDQQAPLVDPMCGAGTIAIEAALMAANIAPALKRERWGFTRWLQHDATLWQ
SLLDDANAQIITPNCVISASDIDHGVVSIAKENADAAGVFSGIKFNTIDACKVIPPKGHT
KGYIVSNPPYGERLSEITALLPLFQAWGTSLKEHFKGWNLSLLTSNRDLLRSMKMFAHKE
YKLMNGKLECQLVNFALDEKNCITRETSLSNNDFANRLNKNIKRLSKWLKSENTNCYRIY
DADLPEYNVAIDRYGDWLVVQEYAAPKNVPEAKAKRRLHEVIVALPQVVDVPAEQIVMKV
RAQQKGKSQYEKVSQKQKMLEVFENGAKFKLNLTDYLDTGLFLDHRVTRQLVQQRVKDKD
VLNLFAYTGSVSVHAALGKAKSVTTVDMSNTYVDWAKENFALNKLKGPYEFIQADCLTWL
ERHNNQYDFIFIDPPSFSNSKRMDTTWDVQRDHVALLRNAVKCLRPGGEIMFSNNLRQFK
LDEEGVSQLGLTIQDITQKTLPEDFKRNPKIHGCWVLTLNA
NT seq 2106 nt   +upstreamnt  +downstreamnt
atgtttgaatttttagtcaccacgtccaaagggctcgatgagctgcttgcccaagaaata
acgaagttgtgtccacaactgtctgtaaaaaccaaacctggccaagtgctgttcaccggt
gagatcgaacaagcatataaaatttgcttgtggtcacgccttgcgaacagggtgatgttg
aaattagccgatggccatgtagacagcgcggatgatgtatatcaaattactagcagcgta
aactggacatcgcacttcagcgtgaatagtacatttgtcgttgatttcgtcggcgcgagt
cattgcattaacaatagccagttcggggcgttgaaaattaaagatgcggtggtagaccaa
tttaatgaattatttgagtcgcggccctcagtgagcaaaatagagcccgatattcgtatt
caagggcgaatgtggagcgacaagttgactgtgtatttagacttgtcaggttcaagttta
caccaacgccattaccgtaccaaaactggtttggcccctgttaaagagcatatcgcgtgc
gctatgttggttcgcagcggatgggccaatgatcagcaagcgccattagttgaccctatg
tgcggtgcgggcactattgctattgaagcagcgttaatggcagccaatattgcccctgca
cttaagcgtgaacgatggggttttacccgttggttacagcacgatgcgacgttgtggcag
tcattattagacgacgcaaacgctcaaattattacccctaactgtgtgattagcgccagt
gacattgatcatggtgttgtgtcgatagcgaaagaaaatgcggatgcagcaggggttttc
tctgggataaaatttaacaccatagatgcctgcaaagttattccacctaaaggacacacc
aaaggttacattgtgagtaaccctccttatggcgagcgcttgagcgaaataacagcgctg
ttaccgttatttcaggcgtggggaacaagtcttaaagagcattttaaaggttggaactta
tctctattaacgtctaatcgagatttgttacgcagcatgaagatgtttgctcacaaagaa
tacaagttaatgaatggcaaacttgagtgtcagttagtcaatttcgctttggatgaaaaa
aactgtattacccgtgaaacaagtctgagtaataatgatttcgcgaatcgtttgaataag
aacatcaaacgtttgagcaaatggctcaaaagtgagaatacaaattgttaccgtatttat
gatgctgatttgccagaatacaacgtcgctattgaccgctatggtgattggttggtcgta
caagagtatgctgcaccaaaaaacgtacctgaagccaaggcgaaacgccggttgcatgaa
gtgattgtggcattgccgcaagtcgttgatgtaccagctgaacaaattgtcatgaaggta
agagcgcagcaaaaaggtaagagtcagtacgaaaaggtatcgcaaaaacaaaaaatgctg
gaagtgtttgaaaatggtgccaaattcaagctgaatctgaccgattaccttgataccggt
ttgtttttagatcaccgagtaacacgtcaacttgtgcagcaacgggttaaagacaaggac
gttctaaatttgtttgcctacacaggcagcgtttccgtgcatgcagcgttgggtaaggca
aagtcagttaccacggtagatatgtcaaatacctatgtggattgggcgaaagaaaacttt
gctttaaataagctaaaagggccttatgaatttattcaagctgactgtttaacctggctt
gagcgccacaacaatcaatatgattttatctttatagatccaccgtcgttttctaactca
aagcgtatggatacgacgtgggatgtacaacgtgaccacgtggcgcttttacgtaacgcg
gttaaatgcttgcgcccaggtggagagatcatgttttcaaataacctgcgccagttcaag
ttagatgaagagggcgtaagtcaattaggcttaacaattcaagatataacccaaaaaaca
ctgccggaagattttaagcgtaaccctaaaattcatggctgctgggtattaacacttaat
gcgtag

DBGET integrated database retrieval system