KEGG   Pseudoalteromonas atlantica: Patl_2551Help
Entry
Patl_2551         CDS       T00372                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
Organism
pat  Pseudoalteromonas atlantica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C AlaDh_PNT_C Pyr_redox_2 Pyr_redox XdhC_C HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABG41067
UniProt: Q15SS1
LinkDB All DBs
Position
3094321..3095346
Genome map
AA seq 341 aa AA seqDB search
MFAAQYIGNKSFNVVEGHAIAPQAGEVRLDVGYVGICGTDMHIYHGVMDQRVSIPQTIGH
EISGVVAQIGEGVEGFTVGEKVVVRPLDWCGECPTCEAGLTHICQNLKFMGIDTPGAFQS
SWTVKARTLHKLPAGVDLKQGALVEPLSVACHDVRRSRLKAGEKAVILGGGPIGQLVAAV
AKSVGAEVLVSEPNDSRREFADELGVKSVNPMDTDLAAYVDQWTGTKGADVVFEVSGVLP
AIQSMTQIAGRRGRIVMVAIHSTAPPIDLFQFFWKELELLGARVYEAADFDWAIELIASG
QIDLKPFISSVSPLADIGSAFANMDGNPQGMKALVECNAEQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctgctcaatatattggtaataaatcattcaacgtagttgaaggtcacgctatt
gcaccacaagccggtgaagttcgccttgatgttggctatgtaggcatctgtggcaccgac
atgcatatttaccatggcgtgatggaccagcgtgtgtctattccacaaaccataggtcac
gaaatttcaggggttgtggcgcaaatcggtgaaggcgtagaaggctttacggttggtgaa
aaagtcgtggttcgcccactggactggtgcggtgaatgccctacctgcgaagcaggttta
acgcacatttgtcaaaatctcaaattcatgggtatcgacacccctggtgcttttcaatca
agttggacggtaaaagcccgtactttgcataaattgccggcaggtgtggatttaaaacaa
ggtgcattggtcgagcctctttctgtggcttgccatgacgtgcgccgttctcgcttaaaa
gccggtgaaaaagcggttatcctcggcggtggccctatcggtcaattggttgcagcggtc
gctaaaagcgttggcgctgaggtattggtgtctgagccgaacgacagtcgccgcgaattt
gccgacgagcttggggtgaagtctgttaatcctatggataccgacttagcggcctacgtc
gaccaatggacagggacaaaaggtgctgacgtagtatttgaagtatccggtgtgttaccc
gccattcaatcgatgacccaaattgctggacgtcgtggccgcatagtgatggtggcgatt
cactccactgcaccaccaattgatttgttccagttcttctggaaagagcttgaactattg
ggtgcccgcgtttatgaagccgctgattttgattgggcaattgaattaatcgccagtggt
caaatagacttaaaacctttcatcagctctgtgagtccgctggcagatatcggcagtgca
tttgccaatatggacggcaatccgcagggcatgaaagccctggttgaatgtaacgctgag
caataa

DBGET integrated database retrieval system