KEGG   Pectobacterium atrosepticum 21A: GZ59_00850Help
Entry
GZ59_00850        CDS       T03293                                 

Gene name
tag
Definition
(GenBank) DNA-3-methyladenine glycosylase I
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
pato  Pectobacterium atrosepticum 21A
Pathway
pato03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:pato00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    GZ59_00850 (tag)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pato03400]
    GZ59_00850 (tag)
Enzymes [BR:pato01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     GZ59_00850 (tag)
DNA repair and recombination proteins [BR:pato03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     GZ59_00850 (tag)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenine_glyco
Motif
Other DBs
NCBI-ProteinID: AIK12002
LinkDB All DBs
Position
complement(96569..97132)
Genome map
AA seq 187 aa AA seqDB search
MQRCGWVTQDTLYQDYHDNEWGKPCTDSQKLFELLCLEGQQAGLSWITVLKKRENYRRCF
HQFNPEQVAKMTQDDVDRLVQDSGIIRHRGKIEAIITNAKIWVAMESQGESFSHFIWSFV
EHQPRLNHPASLAEVPAKTDVSDAMSKALKKRGFKFIGSTICYAFMQAGGLVNDHVTDCF
CHQKSTS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgctgcggctgggttacacaagacaccttatatcaggattaccacgataacgag
tgggggaagccctgcaccgacagccagaagctatttgagctactgtgtctggagggccag
caggcgggcctttcctggatcaccgtcctgaaaaaacgcgaaaactatcgccgttgtttt
caccagttcaatcctgaacaagtagcaaaaatgacgcaggatgacgtggatcgactggtg
caggacagcggtattatccgccaccgtgggaaaatcgaggcgatcatcaccaatgcaaaa
atatgggtggcgatggaaagtcagggagagagtttctcgcacttcatttggtcttttgtc
gaacaccaaccgcgtctcaatcacccagcttcacttgcagaggttcctgccaaaacggac
gtttcagatgccatgtcaaaagccctgaagaaacgcggcttcaaatttatcggttcaact
atctgttatgccttcatgcaggcgggcggattggtcaacgaccatgtcaccgactgtttt
tgtcatcagaaaagcacatcatga

DBGET integrated database retrieval system